SecReT6
Protein ID: 300693662
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0652
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]802006..802797 [-]
Productsecretion system protein
NoteTssL
UniProt IDD8N057
KEGG IDrsl:RPSI07_mp0652
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.40E-56, Aligned region: 33..234
Protein Sequence: 263 a.a.     [Download]
>gi|300693662|ref|YP_003749635.1| secretion system protein [Ralstonia solanacearum PSI07]
MSATTTPSLFGGSASPAGNASADAHESSTHVRTLLDLLYDGFFMLFQLRNGQQPTSAEDFLARVRAFLED
FDRGAKRLNVSAEDVFDAKYAFCAAVDETILSSNFSIRTAWERCPLQLELFGEQLAGETFFIKLEELRAH
GAPRLQALEVFHMCLLLGFRGKYILEGPEKLAYLTARLGDEISAIKGKRAAFAPHWLLPDKVAHRLKRET
PLWIFGAVFALIALLGYIGLSSTLRTKTNETLEGYSQVIKLGPRFSHLTISLP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|300693042|ref|NC_014310.1|:c802797-802006 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGAGCGCTACCACCACGCCTTCCCTGTTCGGCGGCTCGGCCTCCCCGGCCGGCAACGCCTCGGCCGATG
CGCATGAATCCAGCACGCACGTGCGCACGCTGCTGGACCTGCTCTATGACGGCTTCTTCATGCTCTTCCA
GTTGCGCAACGGCCAGCAGCCGACCAGCGCGGAAGACTTCCTCGCCCGCGTGCGCGCCTTCCTGGAAGAC
TTCGACCGCGGGGCCAAGCGGCTGAACGTGTCGGCCGAAGACGTGTTCGACGCCAAGTACGCGTTCTGCG
CCGCCGTGGACGAGACCATCCTGTCGTCCAATTTCTCCATCCGCACCGCGTGGGAGCGCTGTCCGCTGCA
GCTGGAGCTGTTCGGCGAGCAGCTCGCCGGCGAAACGTTCTTCATCAAGCTGGAAGAACTGCGTGCCCAC
GGTGCCCCCCGCCTGCAGGCGCTGGAGGTATTCCACATGTGCCTGCTGCTGGGCTTCCGCGGCAAGTACA
TCCTCGAAGGGCCGGAGAAGCTGGCCTACCTGACCGCACGCCTGGGCGACGAGATCTCCGCCATCAAGGG
CAAGCGCGCGGCCTTCGCGCCGCACTGGCTGCTGCCGGACAAGGTGGCGCACCGGCTCAAGCGCGAGACG
CCGCTGTGGATCTTCGGCGCGGTGTTCGCGCTGATCGCGCTGCTGGGGTATATCGGCCTGTCATCCACGC
TGCGCACGAAGACGAACGAGACGCTGGAAGGCTATTCGCAGGTCATCAAGCTGGGGCCGCGCTTCTCGCA
CCTGACCATCTCGCTGCCCTGA