SecReT6
Protein ID: 300693663
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0653
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]802794..804140 [-]
Producthypothetical protein
NoteTssK
UniProt IDD8N058
KEGG IDrsl:RPSI07_mp0653
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.20E-132, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|300693663|ref|YP_003749636.1| hypothetical protein RPSI07_mp0653 [Ralstonia solanacearum PSI07]
MSYSAKILWGEGLFLRPQHFQRQDAYHESRLHATAQMIQPYGWGIRHAQFDTDALASGVLRATELSLFFP
DGELYFAPQADTLPPPLVLDAIPAGVSELTFHLALYPLQDSGGNYHEQPEGTTVSRFVSTEAETADLFTE
AESAAITYLKKSVKLVADTEPRDQFISLPVVRVRRTGTGGFELDDSFVAPSLSINASSVLYLRLRRLLDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTANAAFAALSHLYHHPDLHPERLFQEMLRLAGALMT
FTKSYTLTDLPAYDHDGPGPVFSRLDTIVRELLDTVISTRYFAIALEETRPSFHLGRIDSGKIDDKTSFY
LSVSADMPVAELVEAIPARFKVGAPDDVDKLVLSSMPGVPLTYTPQVPPAIPVRPGACYFAVESRGMLYE
RMLQAQTITIYAPAGIRELKLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|300693042|ref|NC_014310.1|:c804140-802794 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
GTGAGCTATTCCGCCAAAATCCTCTGGGGCGAAGGGCTGTTCCTGCGGCCCCAGCACTTCCAGCGCCAGG
ACGCGTACCACGAGTCCCGCCTGCATGCGACGGCGCAGATGATCCAGCCGTACGGATGGGGCATCCGTCA
CGCGCAGTTCGATACCGACGCCCTCGCCAGCGGCGTGCTGCGCGCGACCGAGCTGTCGCTGTTCTTTCCG
GACGGCGAGCTGTACTTCGCGCCGCAGGCCGATACCCTGCCGCCGCCGCTCGTACTGGATGCCATCCCGG
CCGGCGTGTCGGAGCTGACCTTCCACCTCGCGCTCTATCCGCTGCAGGACAGCGGCGGCAACTACCACGA
GCAGCCCGAGGGCACCACCGTGTCGCGCTTCGTCTCCACCGAGGCGGAGACGGCGGATCTGTTCACCGAG
GCCGAGTCCGCCGCCATCACCTACCTCAAGAAGTCGGTGAAGCTGGTGGCGGACACCGAGCCGCGCGACC
AGTTCATCTCGCTGCCCGTGGTGCGGGTGCGCCGGACCGGCACCGGCGGCTTCGAGCTGGACGACAGCTT
CGTCGCGCCAAGCCTGTCGATCAATGCGTCTTCCGTGCTGTACCTGCGCCTGCGCCGGCTGCTGGACGCG
CTGCAGGCCAAGGTCAACGCGCTGTATGGCTTCCACCGCGAGCCGACCAAGAACATCATCGAATTCCGCT
CGGGCGATATTGCGTCGTTCTGGCTGCTGCACACGGCCAATGCCGCCTTTGCGGCGCTGTCGCACCTCTA
TCACCACCCGGACCTGCATCCGGAGCGGCTGTTCCAGGAGATGCTGCGCCTGGCCGGCGCGCTGATGACG
TTCACCAAGAGCTACACCCTGACCGATCTGCCGGCCTATGACCACGACGGCCCCGGCCCGGTGTTCTCCC
GGCTGGACACCATCGTGCGCGAGCTGCTCGATACCGTGATCTCGACGCGCTACTTCGCGATCGCGCTGGA
AGAGACACGGCCTTCGTTCCATCTCGGCCGGATCGACTCCGGCAAGATCGACGACAAGACCAGCTTCTAC
CTCTCGGTGTCGGCCGACATGCCGGTGGCGGAACTGGTGGAGGCGATTCCCGCGCGCTTCAAGGTCGGCG
CGCCGGACGACGTGGACAAGCTGGTGCTGTCGTCCATGCCGGGCGTGCCGCTCACCTATACGCCGCAGGT
GCCGCCCGCCATTCCGGTGCGCCCGGGTGCGTGCTACTTCGCGGTCGAGTCGCGCGGCATGCTGTACGAG
CGCATGCTGCAGGCCCAGACCATCACCATCTATGCCCCGGCCGGCATCCGGGAACTCAAACTTGAACTCA
TTGCGGTGACCTCATGA