SecReT6
Protein ID: 300693664
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0654
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]804196..804777 [-]
Producthypothetical protein
NoteTssJ
UniProt IDD8N059
KEGG IDrsl:RPSI07_mp0654
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.10E-37, Aligned region: 4..163
Protein Sequence: 193 a.a.     [Download]
>gi|300693664|ref|YP_003749637.1| hypothetical protein RPSI07_mp0654 [Ralstonia solanacearum PSI07]
MAVVALTACSTGASVLAGAASGALEAVGLKTSNVPDAQKPPREVPLKLTAGANLNAATDRRPVALVVRLY
ALKDPTSFLQAPYDTFIDPAREKQTLGADLVQVREMTLIPGQRYEFSEKVSREASTLGVVALFRSPAAQR
WKFAFNAEKNEKSGIMIGLHACAMTLTTGTPTTPAGSAPLSDLNLLSPASCGG
 
Nucleotide Sequence: 582 bp     [Download]
>gi|300693042|ref|NC_014310.1|:c804777-804196 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGGCCGTGGTCGCCCTGACCGCCTGCTCGACCGGCGCCAGCGTGCTGGCAGGCGCCGCCAGTGGCGCGC
TGGAGGCCGTGGGGCTGAAGACATCGAACGTGCCGGACGCACAGAAGCCGCCCCGCGAGGTTCCGCTCAA
GCTGACCGCCGGCGCCAACCTGAACGCGGCGACGGACCGCCGCCCGGTCGCGCTGGTGGTCCGGTTATAT
GCCCTCAAGGACCCGACCAGTTTCCTGCAAGCGCCGTATGACACGTTTATTGACCCGGCGCGTGAAAAAC
AGACACTCGGAGCCGACCTGGTCCAGGTCCGGGAAATGACGCTGATTCCCGGCCAGCGCTATGAATTCTC
GGAAAAGGTCTCGCGTGAAGCCAGTACACTGGGCGTTGTTGCGCTATTCCGCAGTCCCGCCGCCCAACGG
TGGAAATTTGCTTTTAATGCAGAAAAGAATGAAAAGAGCGGCATCATGATCGGATTGCATGCTTGCGCGA
TGACCCTGACCACGGGCACACCGACCACCCCCGCCGGCAGCGCGCCGCTGTCCGACCTGAACCTGCTTTC
ACCGGCAAGCTGCGGCGGTTGA