SecReT6
Protein ID: 300693666
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0656
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]805843..806355 [+]
Producthypothetical protein
NoteTssB
UniProt IDD8N061
KEGG IDrsl:RPSI07_mp0656
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.50E-59, Aligned region: 11..164
Protein Sequence: 170 a.a.     [Download]
>gi|300693666|ref|YP_003749639.1| hypothetical protein RPSI07_mp0656 [Ralstonia solanacearum PSI07]
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVADLAGQSEVPQPKLRDRKFVNIDRDNF
DDVMSAVEPRAAFQVPNTLTEEGGRFGVDLKFRSLEDFTPEAVVGQIEPLRQLLEARSKLADLRNKLAGN
DKLEDLLSEVLNNTEALQKLSAKKDGGEDA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|300693042|ref|NC_014310.1|:805843-806355 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGGCCAAGAAAGAAAGTGTGCAGAAGCGTCTGCAGAAGGTGCGCCCCCCGCGCGTGCAGCTGACGTACG
ACGTCGAAAAAGGCGACGCGATCGAGCAGAAGGAACTGCCGTTCGTGGTCGGCGTGGTGGCGGACCTGGC
GGGCCAGTCGGAAGTGCCGCAGCCCAAGCTGCGTGACCGCAAGTTCGTCAACATCGATCGCGACAACTTC
GACGACGTGATGTCGGCGGTCGAGCCACGCGCCGCCTTTCAGGTGCCGAACACGCTGACGGAAGAGGGTG
GCCGCTTCGGCGTCGACCTCAAGTTCCGTTCGCTGGAGGATTTCACGCCGGAAGCCGTGGTGGGCCAGAT
CGAGCCGCTGCGCCAGTTGCTGGAGGCACGTTCCAAGCTGGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTGGAAGACCTGCTGTCCGAGGTGCTGAACAACACCGAGGCACTGCAGAAACTCAGCGCCAAGA
AGGATGGGGGCGAGGATGCTTGA