SecReT6
Protein ID: 300693667
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0657
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]806348..807838 [+]
Producthypothetical protein
NoteTssC
UniProt IDD8N3A5
KEGG IDrsl:RPSI07_mp0657
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.60E-193, Aligned region: 68..491
Protein Sequence: 496 a.a.     [Download]
>gi|300693667|ref|YP_003749640.1| hypothetical protein RPSI07_mp0657 [Ralstonia solanacearum PSI07]
MLDNQSAALAQSAPAAEAVNLLDQIVDQSRVAKSDAEHARAKDIIGELVNQVLQGTVVVSDNLSATLDAR
VAELDRLISSQLSAVMHTPEFQKLESTWRGLSYLVKETQTGTMIKIKVLNATKRDLVRDFKTAIDFDQSA
LFKKVYEEEFGTFGGAPFGTLIGDFEVTRQPEDVYFIEQMSHVAAASHAPFIASSSPELFGLESFADLGK
PRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDGTDHSKYLWCN
AAWAFGARLTAAFEDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYDTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAKNV
ETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEVPGKPGTYRSVAFLRPHFQLDELSISLRLVADL
PKPTNS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|300693042|ref|NC_014310.1|:806348-807838 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGCTTGACAACCAATCCGCCGCGCTCGCGCAGAGCGCACCGGCAGCCGAGGCCGTCAACCTGCTCGACC
AGATCGTCGACCAGAGCCGTGTCGCCAAGTCGGACGCCGAGCACGCACGTGCCAAGGACATCATCGGCGA
GCTGGTCAACCAGGTGCTCCAGGGCACGGTGGTGGTGTCCGACAACCTGTCGGCCACGCTGGATGCCCGC
GTGGCTGAGCTGGACCGCCTGATCTCGTCGCAGCTGAGCGCCGTCATGCACACGCCCGAGTTCCAGAAGC
TGGAGAGCACGTGGCGCGGCCTGTCGTACCTGGTCAAGGAAACGCAGACCGGCACGATGATCAAGATCAA
GGTGCTCAACGCCACCAAGCGCGATCTCGTGCGCGACTTCAAGACGGCCATCGATTTCGATCAGAGCGCG
CTGTTCAAGAAGGTGTACGAAGAAGAGTTCGGCACCTTCGGCGGTGCGCCGTTCGGCACGCTGATCGGCG
ATTTCGAAGTCACGCGCCAGCCGGAAGACGTGTACTTCATCGAGCAGATGTCGCACGTGGCAGCGGCCTC
GCATGCGCCGTTCATCGCCTCGTCCTCGCCGGAGCTGTTCGGCCTGGAATCGTTTGCCGACCTGGGCAAG
CCGCGCGATCTGGCCAAGGTGTTCGATACGGTCGAATACGCCAAGTGGAAGTCGTTCCGCGAGTCGGAGG
ATTCGCGCTACGTGGGCCTGACGATGCCGCGCTTCCTGGGCCGGTTGCCGTACAACCCCAAGGATGGCAC
CACCGTCGAGGGCTTCAACTTCGTCGAAGACGTGGACGGCACCGACCACAGCAAGTACCTGTGGTGCAAC
GCGGCCTGGGCTTTCGGTGCACGGCTGACCGCCGCGTTCGAAGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTGGAAGGCGGCGGGCTGGTCGAAGACCTGCCGACGCACACCTTCAAGACCGATGACGGCGAAATCGC
GCTCAAGTGCCCGACGGAAATCGCCATCACCGATCGCCGCGAGAAGGAACTGAGCGACCTGGGCTTCATC
CCGCTCGTGCACTGCAAGAACTCGGATTACGCAGCGTTCTTCGCGGCGCAGTCGGTGCAGAAGCCCAAGA
AGTACGACACCGACAGCGCGAATGCCAACGCGGTGCTGTCGGCGCAGCTGCAGTACATCTTCTCGGTATC
GCGCGTGGCGCACTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCATCGGCCAAGAATGTC
GAGACCTTCCTCAACCGATGGATTTCGCAGTACGTCCTGCTGGATGACAACGCGACCCAGGAGCAGAAGG
CGCAGTTCCCGCTGCGCGAGGCTTCGATCCAGGTGTCCGAAGTGCCCGGCAAGCCCGGTACGTACCGCTC
GGTGGCGTTCCTGCGGCCGCACTTCCAGCTTGATGAACTGTCGATCTCGCTGCGGCTGGTGGCGGACCTG
CCGAAGCCAACCAATTCCTGA