SecReT6
Protein ID: 300693669
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0659
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]808491..808964 [+]
Productsecretion system protein
NoteTssE
UniProt IDD8N063
KEGG IDrsl:RPSI07_mp0659
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.30E-19, Aligned region: 29..137
Protein Sequence: 157 a.a.     [Download]
>gi|300693669|ref|YP_003749642.1| secretion system protein [Ralstonia solanacearum PSI07]
MKGFEPSLLDKLFDDEPHAPMPTALRQLSLEELKSTVARDIESLLNTRIVFEEEDLQGLPECKRSLLTYG
LNDFAGLSLASFYDRNYICQSLTKAIERHEPRLQHVSVSLEINERATNALCFGISAVLLVGPAREPVNFD
AMLQPSTLRYSVSRGRG
 
Nucleotide Sequence: 474 bp     [Download]
>gi|300693042|ref|NC_014310.1|:808491-808964 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGAAAGGCTTCGAACCCAGCCTGCTCGACAAGCTCTTCGACGACGAGCCGCATGCTCCCATGCCCACGG
CTCTGCGGCAGCTTTCGCTGGAGGAGCTCAAGAGCACGGTGGCGCGCGATATCGAGTCCTTGCTCAATAC
GCGCATCGTCTTTGAAGAGGAAGACCTGCAGGGCCTGCCCGAATGCAAGCGGTCGCTGTTGACCTACGGG
TTGAACGATTTCGCGGGCCTGAGCCTTGCCAGCTTCTACGATCGCAATTACATCTGCCAGTCGCTCACCA
AGGCGATCGAGCGGCACGAGCCGCGGCTGCAGCACGTCAGCGTCTCGCTGGAAATCAACGAGCGGGCGAC
CAACGCGCTGTGCTTCGGCATCAGTGCCGTCTTGCTGGTCGGGCCGGCGCGCGAGCCCGTGAACTTTGAT
GCGATGCTGCAGCCGTCCACGCTGCGGTATTCCGTCTCGCGCGGGCGCGGCTGA