SecReT6
Protein ID: 300693670
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0660
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]809027..810877 [+]
Producttype VI secretion protein (duf879)
NoteTssF
UniProt IDD8N064
KEGG IDrsl:RPSI07_mp0660
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-210, Aligned region: 4..615
Protein Sequence: 616 a.a.     [Download]
>gi|300693670|ref|YP_003749643.1| type VI secretion protein (duf879) [Ralstonia solanacearum PSI07]
MEELLPYYERELAFLRRYSRDFAERYPKIAGRLAMSGDGCDDPHVERMIESFALLTARVSKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSVVHFDVRGVAAQLSAPVQIPRGTFLTSRVVRKVECRFRTAYDVTFAPVRI
AAAAFERAVSAPSAVSLPKGATGAIALTLEYVGERGGFESLPLDRLRVYMDGEPSFVAALGDALFLHTAA
AYVEGDRPGVWTRLSGVPLHEVGFTEDEALIDCPARSHPAYRLLTEHFSFAEKFNFFDIDLAVVRRGLTP
GVPVRRLVLHLVLKDVRSDSHAARLLEGLQAEHLRLHCTPVVNLFQQKADPIRIEHTASAYPVVADSRRA
HGFDIYSIDKVHLVRETAAHEEVTEFRPFYSLHHGEEPGRAGHYWIARRNELVAQRSPGFETEISIVDTQ
FDPASPQTDTLSLTVTCTNRDLPSTLAFGQPDGDLSMEGSSIARSITFLRKPTPSMRLGGGRAAQWRLIS
LLALNHLSLVQNGLPTLKEMLRLHDLPHSAISARQVEGIVGLDYAPATHWLAGKPFATFVRGLEIRLTLD
EDAFVGTGLHRFIRVLDHFFGLYVHINSFVQLIAVSRRSGKELVRCAPRSGESILV
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|300693042|ref|NC_014310.1|:809027-810877 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGGAAGAGCTGCTGCCCTATTACGAACGAGAACTGGCCTTCCTGCGCCGGTACTCGCGCGACTTCGCCG
AACGCTACCCGAAGATCGCAGGCCGGCTCGCCATGTCGGGCGACGGCTGCGACGATCCACACGTCGAGCG
GATGATCGAGTCGTTCGCGTTGCTGACCGCGCGCGTCAGCAAGAAGCTGGACGACGATTACCCCGAATTC
ACCGAAGCGCTGCTGGAGGTCCTGTACCCCCATTACCTGCGCCCGTTCCCGTCGTGCTCCGTGGTGCATT
TCGATGTGCGCGGCGTGGCGGCCCAGCTCAGTGCGCCGGTGCAGATTCCGCGCGGCACCTTCCTGACCTC
GCGCGTGGTGCGCAAGGTCGAGTGCCGCTTCCGCACCGCCTACGATGTCACCTTTGCCCCGGTGCGGATT
GCCGCGGCCGCCTTCGAGCGCGCCGTGTCCGCGCCGTCGGCGGTCAGCCTGCCCAAGGGGGCGACCGGTG
CAATCGCGCTGACGCTGGAATATGTCGGTGAGCGCGGCGGTTTCGAATCCTTGCCGCTCGACCGGCTGCG
CGTCTACATGGATGGCGAGCCCTCGTTTGTGGCCGCGCTGGGTGATGCGCTGTTCCTGCATACCGCGGCG
GCCTATGTGGAGGGCGATCGCCCGGGCGTGTGGACCCGCTTGTCCGGCGTGCCCCTGCACGAGGTCGGCT
TTACGGAAGACGAGGCGCTGATCGATTGTCCGGCGCGTTCGCATCCGGCCTATCGGCTGCTGACCGAGCA
CTTCAGCTTTGCCGAGAAATTCAACTTCTTCGACATCGATCTGGCGGTCGTGCGGCGCGGGCTGACGCCC
GGCGTGCCGGTCCGCCGCCTGGTGCTGCACCTGGTCCTGAAGGACGTGCGCAGCGACTCGCACGCTGCCC
GCCTGCTCGAGGGCCTGCAGGCCGAACACCTGCGCCTGCATTGCACGCCGGTGGTCAACCTGTTCCAGCA
GAAGGCCGATCCGATCCGCATCGAGCATACCGCCAGCGCCTATCCGGTCGTGGCCGACAGCCGCCGCGCG
CACGGCTTCGACATCTACTCGATCGACAAGGTGCACCTGGTGCGCGAGACCGCCGCGCACGAGGAGGTGA
CCGAGTTCCGCCCGTTCTACTCGCTGCACCACGGCGAGGAGCCCGGGCGCGCGGGCCACTACTGGATCGC
CCGGCGCAACGAGCTGGTGGCGCAGCGCAGCCCCGGCTTCGAGACCGAGATTTCCATCGTCGATACGCAG
TTCGACCCGGCCAGCCCGCAGACCGACACGCTGAGCCTGACCGTCACCTGCACCAACCGCGATCTGCCGT
CCACGCTGGCGTTCGGCCAGCCGGACGGCGACCTGTCGATGGAAGGCAGCTCCATCGCCCGCAGCATCAC
GTTCCTGCGCAAGCCGACGCCGTCGATGCGCCTGGGCGGCGGCCGTGCGGCGCAGTGGCGGCTGATTTCG
CTGCTGGCGCTCAACCATCTGTCGCTGGTGCAGAACGGGCTGCCGACGCTCAAGGAGATGCTGCGCCTGC
ATGACCTGCCGCACAGCGCCATTTCGGCGCGGCAGGTCGAGGGCATCGTCGGTCTCGACTACGCGCCGGC
CACGCATTGGCTGGCCGGCAAGCCGTTCGCCACCTTCGTGCGGGGGCTGGAGATCCGGCTCACGCTGGAC
GAAGACGCCTTTGTCGGCACGGGCCTGCATCGCTTCATCCGCGTGCTGGACCATTTCTTCGGCCTGTACG
TCCACATCAACAGCTTTGTGCAGCTGATTGCGGTATCGCGCCGCAGCGGCAAGGAACTGGTCAGATGCGC
ACCCCGCAGCGGCGAATCGATCCTGGTGTGA