SecReT6
Protein ID: 300693671
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0661
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]810841..811944 [+]
Producttype VI secretion protein, vc_a0111 family
NoteTssG
UniProt IDD8N065
KEGG IDrsl:RPSI07_mp0661
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.70E-92, Aligned region: 18..348
Protein Sequence: 367 a.a.     [Download]
>gi|300693671|ref|YP_003749644.1| type VI secretion protein, vc_a0111 family [Ralstonia solanacearum PSI07]
MRTPQRRIDPGVIRRLLRQPHRYEFFQAVRLLEQLFARRGNGAPEHALATRVSFRNTLALSFPPSELQAI
EAGRVTPDMLESDAAFIAALEDGALDTVAITPTFFGLLGVQGALPLRYTEIVAEREAMWRDRAARAFFDI
FSNRATALFYQAWKKYRLPFQYEVDNNRHYLPLLLSLAGAADKTLRHDLSGTPGPVHDEALAGYATAIRH
RPVSAAYLQRVLADYFQAPMRVEQFVGNWYRVPPSQYSRLGGTNNVLGATALAGARVWQRDLRVRVWVGP
MARKQYRNFLPGAPGALALRKMLTILCGATLEFEIKLILRRQDVAGCTLGAQDSGHSAGRLGWDTFLCSR
PAQHDRSDAQYTLAPLH
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|300693042|ref|NC_014310.1|:810841-811944 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGCGCACCCCGCAGCGGCGAATCGATCCTGGTGTGATCCGCCGGCTGCTCCGGCAGCCGCACCGGTATG
AGTTCTTCCAGGCCGTGCGGCTGCTGGAGCAGCTGTTTGCGCGCCGGGGCAATGGCGCCCCCGAGCATGC
GCTGGCCACCCGCGTGAGTTTCCGCAATACGCTGGCCCTGTCGTTTCCGCCCAGCGAGCTGCAGGCCATC
GAGGCCGGGCGCGTGACGCCGGACATGCTGGAGAGCGATGCGGCCTTCATCGCGGCGCTCGAAGACGGCG
CGCTCGATACCGTGGCCATCACGCCGACCTTCTTCGGCCTGCTCGGCGTGCAGGGGGCGCTGCCGCTGCG
CTACACCGAGATCGTCGCCGAGCGCGAGGCCATGTGGCGCGATCGCGCCGCGCGGGCCTTCTTCGACATC
TTCTCGAACCGCGCGACGGCGCTGTTCTACCAGGCCTGGAAGAAGTACCGTCTGCCGTTCCAGTACGAAG
TCGACAACAACCGGCATTACCTGCCGCTGCTGCTGTCGCTGGCCGGCGCCGCGGACAAGACGCTGCGCCA
CGATCTGTCCGGCACGCCGGGGCCGGTCCATGACGAAGCGCTGGCCGGCTATGCCACGGCGATCCGCCAT
CGGCCCGTGTCGGCGGCGTACCTGCAGCGCGTGCTGGCCGATTACTTCCAGGCGCCGATGCGCGTCGAGC
AGTTTGTCGGCAACTGGTATCGCGTGCCACCGTCGCAGTATTCGCGGCTGGGCGGCACCAACAACGTGCT
GGGCGCCACCGCGCTGGCCGGCGCCCGTGTTTGGCAGCGTGACCTGCGGGTGCGCGTGTGGGTCGGTCCG
ATGGCGCGCAAGCAGTACCGCAACTTCCTGCCGGGGGCGCCCGGCGCACTGGCGTTGCGCAAGATGCTGA
CCATCCTGTGCGGCGCCACGCTCGAATTCGAAATCAAGCTGATCCTGCGCCGCCAGGATGTGGCCGGCTG
CACGCTGGGCGCGCAGGACAGCGGCCACAGTGCCGGCCGACTGGGCTGGGACACCTTCCTGTGCTCGCGT
CCGGCGCAGCACGACCGCAGCGACGCGCAGTACACCCTCGCACCGCTGCATTGA