SecReT6
Protein ID: 300693672
SecReT6 ID404
T6SS typei4b
Gene symbolclpB
Locus tagRPSI07_mp0662
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]811977..814694 [+]
Productchaperone clpb
NoteTssH
UniProt IDD8N066
KEGG IDrsl:RPSI07_mp0662
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.20E-43, Aligned region: 232..313
AAA_2 [PF07724], Evalue: 4.20E-43, Aligned region: 635..802
AAA [PF00004], Evalue: 2.00E-19, Aligned region: 232..345
AAA [PF00004], Evalue: 2.00E-19, Aligned region: 640..758
AAA_5 [PF07728], Evalue: 9.70E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 9.70E-13, Aligned region: 640..758
ClpB_D2-small [PF10431], Evalue: 8.40E-12, Aligned region: 386..403
ClpB_D2-small [PF10431], Evalue: 8.40E-12, Aligned region: 811..886
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 209..252
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 477..509
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 614..678
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 706..728
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 802..841
Clp_N [PF02861], Evalue: 4.20E-10, Aligned region: 23..74
Clp_N [PF02861], Evalue: 4.20E-10, Aligned region: 114..128
AAA_22 [PF13401], Evalue: 2.60E-07, Aligned region: 231..318
AAA_22 [PF13401], Evalue: 2.60E-07, Aligned region: 636..660
AAA_22 [PF13401], Evalue: 2.60E-07, Aligned region: 701..733
Sigma54_activat [PF00158], Evalue: 3.60E-06, Aligned region: 211..248
Sigma54_activat [PF00158], Evalue: 3.60E-06, Aligned region: 637..740
AAA_25 [PF13481], Evalue: 5.20E-06, Aligned region: 227..262
AAA_25 [PF13481], Evalue: 5.20E-06, Aligned region: 288..328
AAA_25 [PF13481], Evalue: 5.20E-06, Aligned region: 634..657
Arch_ATPase [PF01637], Evalue: 3.20E-05, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 3.20E-05, Aligned region: 284..368
Arch_ATPase [PF01637], Evalue: 3.20E-05, Aligned region: 636..676
Arch_ATPase [PF01637], Evalue: 3.20E-05, Aligned region: 710..733
AAA_29 [PF13555], Evalue: 7.20E-05, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 7.20E-05, Aligned region: 635..664
AAA_29 [PF13555], Evalue: 7.20E-05, Aligned region: 732..766
AAA_19 [PF13245], Evalue: 7.40E-05, Aligned region: 232..258
AAA_19 [PF13245], Evalue: 7.40E-05, Aligned region: 635..661
AAA_17 [PF13207], Evalue: 0.00017, Aligned region: 196..226
AAA_17 [PF13207], Evalue: 0.00017, Aligned region: 232..295
AAA_17 [PF13207], Evalue: 0.00017, Aligned region: 639..675
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 224..254
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 639..657
AAA_18 [PF13238], Evalue: 0.0014, Aligned region: 232..252
AAA_18 [PF13238], Evalue: 0.0014, Aligned region: 641..664
NACHT [PF05729], Evalue: 0.002, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.002, Aligned region: 640..660
Zeta_toxin [PF06414], Evalue: 0.0026, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.0026, Aligned region: 631..679
T2SE [PF00437], Evalue: 0.003, Aligned region: 215..249
T2SE [PF00437], Evalue: 0.003, Aligned region: 627..676
AAA_23 [PF13476], Evalue: 0.0081, Aligned region: 232..248
AAA_23 [PF13476], Evalue: 0.0081, Aligned region: 443..492
AAA_23 [PF13476], Evalue: 0.0081, Aligned region: 636..666
Protein Sequence: 905 a.a.     [Download]
>gi|300693672|ref|YP_003749645.1| chaperone clpb [Ralstonia solanacearum PSI07]
MATPLKTLIAKLNATSRQAAERAASLCMARGHYEVDLEHLFLALLENRRSDFAVAARASGIDLAALQRDL
EAEIARFQTGNTRTPAFSPYLPKLFEHAWLIASLDSQITRIRSGHLLLALLTEPSLAALAERGSRLFGRF
EVERLKHEFERMTAGSDEQEQAVDFVDGTAAHSEDGRTAPAAALTSTPALDQFTVDLTQAAREGRIDPVI
GRDAEIRQVVDILMRRRQNNPILTGEAGVGKTAVVEGLALRVAANDVPPPLQGVTLRTLDMGLLQAGASV
KGEFENRLKNVIDEVKKSPKPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVEEPSEPLAASMLRGMAPLMERHFGVRVLDEAITEAVRLSHRYISGRQLPDKAV
SVLDTACAKVALGQSATPGAIEDDQKALERLLGEITALQREQSAGAAHDARLEALQAKRAELDQRIAQNT
ERLAQERALVVRIQALREAREGGTLEAGAQDAEPVAANSDVVAMSPKRARAADEPDELATLLAELRALQG
ETPMVPLQVDGHVVSEIVSAWTGIPLGRMVKDELRTVLNLKPLLAARVIGQDHALDAIAQRVRTASANLE
DPNKPRGVFLFAGPSGVGKTETALALADILYGGERKLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVL
TEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGEMDDAEGRPIDFRNTIIILTSNVGSSAIMQACLNK
PTEALPDADALAEALRPVLYKAFKPAFLGRTKVVPYYPIADDVLAEIITLKLGRIRDRVAANHKAAFQWD
TALVESVLARCTEVDAGARAVDHILNGTLLPEIAEAVLTRMAEGGSVEKIKISVGKTGEFKYRIN
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|300693042|ref|NC_014310.1|:811977-814694 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGGCCACCCCACTCAAGACCTTGATCGCCAAGCTGAACGCGACCAGCCGGCAGGCTGCCGAGCGCGCGG
CCTCGCTGTGCATGGCGCGCGGCCACTATGAAGTCGACCTGGAGCACCTGTTCCTGGCGCTGCTCGAAAA
CCGCCGCAGCGACTTCGCCGTCGCCGCCCGCGCCAGCGGCATCGATCTGGCGGCGCTGCAGCGCGACCTG
GAAGCCGAGATCGCGCGCTTCCAGACCGGCAACACGCGCACGCCGGCGTTCTCGCCGTATCTGCCCAAGC
TGTTCGAGCATGCGTGGCTGATCGCCTCGTTGGATTCGCAGATCACGCGCATCCGCTCGGGCCACCTGCT
GCTCGCGCTGCTGACCGAGCCCAGCCTGGCCGCGCTGGCCGAGCGCGGCTCGCGGCTGTTCGGCCGCTTC
GAGGTGGAGCGGCTCAAGCACGAATTCGAGCGCATGACCGCCGGCTCGGACGAGCAGGAACAGGCCGTCG
ATTTCGTCGACGGTACGGCCGCCCACTCGGAAGACGGCCGCACCGCGCCCGCCGCCGCGCTGACCTCGAC
GCCGGCACTCGACCAGTTCACCGTGGACCTGACGCAGGCCGCCCGCGAAGGCCGCATCGACCCGGTGATC
GGGCGCGACGCCGAGATCCGCCAGGTGGTGGACATCCTGATGCGCCGGCGCCAGAACAACCCCATCCTGA
CCGGCGAGGCCGGTGTCGGCAAGACGGCGGTGGTGGAGGGCCTTGCGCTGCGCGTGGCCGCCAACGACGT
GCCGCCGCCGCTGCAGGGCGTCACGCTGCGCACGCTCGACATGGGCCTGCTGCAGGCCGGCGCGAGCGTG
AAGGGCGAGTTCGAGAACCGCCTGAAGAACGTGATCGACGAGGTCAAGAAGAGCCCCAAGCCGATCATCC
TGTTCATCGACGAGGCGCACACCATCATCGGTGCGGGCGGGCAGGCCGGGCAGAACGATGCGGCCAACCT
GCTCAAGCCGGCGCTGGCGCGCGGCGAGCTGCGCACCATCGCCGCGACCACGTGGAGCGAGTACAAGAAG
TATTTCGAAAAGGATGCGGCCCTCGCGCGCCGCTTCCAGGTCGTCAAGGTCGAAGAGCCCAGCGAGCCGC
TGGCCGCGTCCATGTTGCGCGGCATGGCGCCGCTGATGGAGCGCCACTTCGGCGTGCGCGTGCTGGACGA
GGCCATCACCGAGGCCGTGCGCCTGTCGCATCGCTACATCAGCGGGCGCCAGTTGCCGGACAAGGCTGTG
AGCGTGCTGGATACGGCGTGCGCCAAGGTGGCGCTGGGCCAGAGCGCCACGCCCGGTGCCATCGAGGACG
ACCAGAAAGCGCTGGAGCGCCTGCTGGGCGAGATCACCGCGCTGCAGCGCGAGCAGAGCGCCGGCGCGGC
GCACGATGCCCGCCTGGAAGCGCTGCAGGCCAAGCGCGCTGAGCTGGACCAGCGCATCGCGCAAAACACC
GAGCGCCTGGCCCAGGAGCGCGCGCTGGTGGTGCGCATCCAGGCCCTGCGCGAGGCGCGCGAAGGCGGCA
CATTGGAAGCCGGCGCGCAGGACGCCGAGCCGGTGGCGGCCAACAGCGATGTGGTTGCGATGTCGCCCAA
GCGCGCCCGCGCCGCCGACGAGCCGGACGAGCTCGCCACGCTGCTGGCCGAGCTGCGCGCGTTGCAGGGC
GAAACGCCCATGGTGCCGCTCCAGGTGGACGGCCACGTCGTGTCGGAGATCGTCTCCGCCTGGACCGGCA
TTCCCCTGGGCCGCATGGTCAAGGACGAACTGCGCACCGTGCTGAACCTCAAGCCGCTGCTGGCCGCCCG
CGTGATCGGCCAGGACCACGCGCTGGATGCCATCGCCCAGCGCGTGCGCACTGCCTCGGCCAACCTGGAA
GACCCGAACAAGCCGCGCGGCGTGTTCCTGTTCGCCGGCCCGTCGGGCGTGGGCAAGACCGAGACGGCGC
TGGCGCTGGCCGACATCCTCTATGGCGGCGAGCGCAAGCTCATCACCATCAACATGAGCGAGTACCAGGA
AGCACACAGCGTCTCGGGCCTCAAGGGCTCGCCGCCGGGCTACGTGGGCTACGGCGAGGGCGGCGTGCTG
ACCGAGGCGGTGCGCCGCAATCCGTACAGCGTGGTGCTGCTGGACGAAGTCGAGAAAGCCCACCCCGACG
TGCTGGAGATGTTCTTCCAGGTGTTCGACAAGGGCGAGATGGACGACGCCGAAGGCCGCCCCATCGACTT
CCGCAACACCATCATCATCCTGACCTCGAACGTGGGCTCGTCGGCCATCATGCAGGCCTGCCTGAACAAG
CCCACCGAAGCGCTGCCCGACGCCGACGCCCTGGCCGAGGCGCTGCGGCCGGTGCTGTACAAGGCCTTCA
AGCCGGCCTTCCTGGGGCGGACCAAGGTGGTGCCGTATTACCCGATTGCCGACGACGTGCTGGCCGAGAT
CATCACGCTCAAGCTCGGCCGCATCCGCGACCGCGTGGCCGCCAACCACAAGGCGGCGTTCCAGTGGGAC
ACCGCGCTGGTGGAATCCGTGCTGGCCCGCTGCACTGAGGTGGACGCGGGCGCGCGCGCGGTCGACCACA
TCCTCAACGGCACGCTGCTGCCCGAGATCGCCGAAGCGGTGCTCACGCGCATGGCCGAGGGCGGCAGCGT
CGAGAAGATCAAGATCAGCGTCGGCAAGACCGGCGAGTTCAAGTACCGCATCAACTGA