SecReT6
Protein ID: 300693673
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0663
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]814715..817465 [+]
Productrhs element vgr-related protein
NoteTssI
UniProt IDD8N3A6
KEGG IDrsl:RPSI07_mp0663
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.50E-70, Aligned region: 42..362
Phage_GPD [PF05954], Evalue: 9.50E-70, Aligned region: 592..604
DUF2345 [PF10106], Evalue: 8.00E-38, Aligned region: 542..583
DUF2345 [PF10106], Evalue: 8.00E-38, Aligned region: 636..660
DUF2345 [PF10106], Evalue: 8.00E-38, Aligned region: 724..885
T6SS_Vgr [PF13296], Evalue: 6.10E-27, Aligned region: 585..689
Phage_base_V [PF04717], Evalue: 7.90E-18, Aligned region: 432..532
Protein Sequence: 916 a.a.     [Download]
>gi|300693673|ref|YP_003749646.1| rhs element vgr-related protein [Ralstonia solanacearum PSI07]
MVSPTELANLLRAAFTQANRLLRLETPLGPNVLLPERLDAAEHLDDGGFRLALTALSDDADLDPARLLGQ
PVRLDLLTQQSRSTLRPFHGHVTQFEQLGANGGLVRYRLVIEPWLAFLRHRRDSFLFQDMSVIEVIDSLF
GDYNGQGRLVPAWRWSLRDASVYARRSVITQYEESDFDFVTRLLAEEGLFYVFEYEAVQGDALGVHRMVI
ADANDVFIDNAQATIRFGRADATASQDVIDRWQGARRWQTNAVSIASWDYRVNAKRSAQPVGGQQREGGP
PLTLLDTDYPGQYWFEDSAQAQRSARVMMEALEVRSRQFDGEGSVRTLAPGTRFQLADHYDHGDDGEARF
AVLSIRHQARNNFNERFGQVLTQTLGALSGPDALDGASNAGTDATFYRNHFTVVRDSVPYRPPRSDTQGR
ALHPRPTVNGGQTALVVGNGGPVHTDRDHRIKVQFHWQRGARSASRQPHPAGDDNARADAGLGSWIRVAA
PVAGPNWGGVALPRVGQEVLVEFLQGDIDRPVVVGAAYNGTGQRDAQYNQNQAGAAGATGNAPAWFAGDS
KSQGAYAHNAVLSGIKTQALAGSQTGASGYNQLVFDDTNGQSRTQLSTTQAATALTLGHHKEQIDSARQA
DLGHGAALATNDSGSVRAGAGLLLTAHAAGTGAALLDSEGAASQIEAISELAESLADVAQKQKAGLPGEP
AAQELPALKQLRHTTEVLRHAESAGEGASAIAYSEPHLQVSAPKGIAAATPADAMLVAGTQATLIAKQDA
TLAAGGNLAMAVADGMTFFAHGKAVGQSSDAAAGIAMHAASGKVGLSSLKGESRLVAEKAVTVASTQGNV
TAEAKAHVRVNAAGAQIKVTNGTIELHAPGKTVFKGAGHTFVGPGGGAASNALAQGNLKACPTKDQGAAA
GGAALL
 
Nucleotide Sequence: 2751 bp     [Download]
>gi|300693042|ref|NC_014310.1|:814715-817465 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGGTCTCACCGACCGAGCTGGCCAACCTGCTGCGGGCGGCCTTCACCCAGGCCAACCGGCTGTTGCGCC
TGGAAACACCGCTCGGGCCCAACGTGCTGCTGCCTGAGCGGCTGGATGCCGCCGAACATCTCGACGACGG
CGGCTTCCGGCTGGCGCTGACCGCGCTGTCCGATGATGCCGATCTCGACCCGGCACGCCTGCTTGGCCAA
CCCGTCCGGCTCGACCTGCTGACCCAGCAAAGCCGCAGCACGCTGCGGCCGTTCCATGGCCACGTCACGC
AATTCGAGCAACTGGGCGCCAACGGCGGGTTGGTGCGCTACCGGCTGGTGATCGAGCCGTGGCTGGCCTT
TTTGCGGCACCGGCGCGACAGCTTCCTGTTCCAGGACATGTCGGTCATCGAGGTGATCGACAGCCTGTTC
GGCGACTACAACGGCCAGGGCCGCCTGGTGCCGGCGTGGCGCTGGTCGCTGCGCGATGCGTCGGTGTATG
CACGCCGCAGCGTCATCACGCAATACGAAGAAAGCGATTTCGACTTCGTCACCCGCCTGCTGGCCGAGGA
AGGGCTGTTCTATGTCTTCGAGTACGAGGCGGTGCAGGGCGATGCGCTGGGCGTGCACCGCATGGTGATC
GCCGATGCCAACGATGTCTTCATCGACAACGCACAGGCCACCATCCGCTTCGGCCGCGCCGATGCCACCG
CCAGCCAAGACGTGATCGACCGCTGGCAGGGCGCGCGGCGCTGGCAGACCAATGCCGTGTCGATCGCCAG
CTGGGACTATCGCGTCAACGCGAAGCGCAGCGCCCAGCCCGTTGGGGGGCAGCAACGTGAGGGTGGCCCG
CCACTCACGCTCCTGGACACCGACTACCCCGGCCAGTACTGGTTTGAAGACAGCGCCCAGGCCCAGCGCA
GCGCGCGCGTGATGATGGAAGCGCTGGAAGTGCGCAGCAGGCAGTTCGACGGCGAAGGCAGCGTGCGCAC
GCTGGCGCCCGGCACGCGCTTCCAGCTGGCCGACCACTACGACCACGGTGACGACGGCGAAGCGCGCTTT
GCCGTGCTGTCCATCCGGCACCAGGCGCGCAATAACTTCAACGAGCGCTTCGGGCAGGTGCTGACGCAGA
CGCTGGGCGCACTGTCCGGCCCCGATGCTCTGGACGGCGCAAGCAACGCGGGCACCGACGCCACGTTCTA
CCGCAACCACTTCACGGTGGTGCGAGACAGCGTGCCATACCGCCCGCCGCGCAGCGATACGCAGGGGCGG
GCATTGCACCCGCGCCCGACGGTCAACGGCGGCCAGACCGCGCTGGTGGTGGGCAACGGCGGGCCGGTGC
ACACCGACCGCGATCACCGCATCAAGGTCCAGTTCCATTGGCAGCGCGGCGCGCGCTCGGCCAGCCGCCA
GCCGCATCCGGCCGGCGACGACAACGCCCGTGCGGATGCCGGCCTGGGCAGCTGGATCCGCGTGGCGGCG
CCGGTGGCCGGCCCCAACTGGGGCGGCGTGGCACTGCCGCGCGTGGGCCAGGAAGTGCTGGTGGAATTCC
TGCAAGGCGATATCGACCGCCCGGTGGTGGTCGGTGCGGCCTACAACGGCACCGGCCAGCGCGACGCGCA
ATACAACCAGAACCAGGCCGGCGCGGCGGGCGCCACCGGCAACGCGCCCGCCTGGTTCGCCGGCGACAGC
AAGAGCCAGGGCGCGTACGCCCACAACGCCGTGCTCTCCGGCATCAAGACCCAGGCCCTGGCCGGCAGCC
AGACGGGCGCCTCGGGCTACAACCAGCTCGTCTTCGACGACACCAACGGCCAGAGCCGCACGCAGCTGAG
CACTACCCAGGCCGCCACCGCGCTCACGCTGGGCCACCACAAGGAACAGATCGACAGCGCCCGCCAGGCC
GATCTCGGCCACGGTGCGGCGCTGGCCACCAACGACAGCGGCAGCGTGCGCGCCGGCGCCGGCCTGCTGC
TGACGGCGCACGCCGCGGGCACCGGCGCCGCGCTGCTCGACAGCGAAGGCGCCGCCAGCCAGATCGAAGC
GATCAGCGAACTGGCCGAATCGCTCGCCGACGTGGCGCAGAAGCAGAAGGCGGGCCTGCCCGGCGAGCCG
GCCGCGCAAGAGCTGCCTGCGCTCAAGCAACTGCGGCACACCACCGAAGTGCTGCGCCACGCGGAAAGCG
CGGGCGAAGGTGCCTCGGCCATCGCCTACAGCGAACCGCATCTGCAGGTCTCGGCCCCCAAGGGCATCGC
CGCGGCCACGCCGGCCGATGCGATGCTGGTGGCGGGTACGCAAGCCACGCTGATCGCCAAGCAGGACGCG
ACCCTCGCGGCGGGCGGCAATCTGGCGATGGCTGTGGCCGATGGCATGACCTTCTTTGCGCATGGCAAGG
CGGTGGGGCAGTCGTCGGATGCGGCGGCCGGCATTGCGATGCATGCGGCCAGCGGCAAGGTGGGCCTGAG
CAGCCTGAAGGGCGAGAGCCGGCTGGTGGCGGAGAAGGCCGTCACGGTGGCGTCCACGCAGGGCAATGTG
ACGGCGGAGGCCAAGGCGCACGTGCGGGTCAATGCGGCGGGGGCGCAGATCAAGGTGACCAACGGCACGA
TTGAGTTGCATGCGCCGGGGAAGACGGTCTTTAAAGGCGCGGGCCATACGTTTGTGGGGCCGGGCGGTGG
GGCGGCGAGCAATGCGTTGGCCCAGGGCAACCTGAAAGCCTGTCCGACCAAAGACCAAGGGGCCGCAGCG
GGCGGTGCCGCTCTTCTGTAA