SecReT6
Protein ID: 300693681
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0674
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]829487..830860 [+]
Productrhs element vgr-related protein (fragment)
NoteTssI
UniProt IDD8N076
KEGG IDrsl:RPSI07_mp0674
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-36, Aligned region: 12..199
Phage_base_V [PF04717], Evalue: 1.20E-17, Aligned region: 269..369
Protein Sequence: 457 a.a.     [Download]
>gi|300693681|ref|YP_003749654.1| rhs element vgr-related protein (fragment) [Ralstonia solanacearum PSI07]
MPRWRSAGSHVSDFDFVTRLLAEEGLFYVFEHEAVQGDALGVHRMVIADANDVFIDNAQATIRFGRADAT
ASQDVIDRWQGVRRWQTNAVSIASWDYRVNAKRSAQLGAQQQREGGPPLTLQDTDYPGQYWFEDSAQAQR
SARVMMEALEVRSRQFDGEGSVRTLAPGTRFQLADHYDHGDDGEARFAVLSIRHQARNNFNERFGQVLTQ
TLGALSGPDALDGASNAGTDATFYRNHFTVVRDSVPYRPPRSDAQGRALHPRPTVNGGQTALVVGNGGPV
HTDRDHRIKVQFHWQRGARSASRQPHPAGDDNARADAGLGSWIRVAAPVAGPNWGGVALPCVGQEVLVEF
LQGDIDRPVVVGAAYNGTGQRDAQYNQNQAGAAGATGNAPAWFAGDSKSQGAYAHNAVLSGIKTQALAGS
QTGASGAGQKKAVPQSNPASGCASPSTIASRWHFRRR
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|300693042|ref|NC_014310.1|:829487-830860 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
TTGCCAAGGTGGCGTAGTGCAGGTTCGCACGTAAGCGATTTCGACTTCGTCACCCGCCTGCTGGCCGAGG
AAGGGCTGTTCTACGTCTTCGAGCACGAGGCGGTGCAGGGTGATGCGCTGGGCGTGCACCGCATGGTGAT
CGCCGATGCCAACGATGTCTTCATCGACAACGCACAGGCCACCATCCGCTTCGGCCGCGCCGATGCCACC
GCCAGCCAAGACGTGATCGACCGCTGGCAGGGCGTGCGGCGCTGGCAGACCAATGCCGTGTCGATCGCCA
GCTGGGACTATCGCGTCAACGCGAAGCGCAGCGCCCAGCTCGGCGCGCAGCAGCAACGTGAGGGTGGCCC
GCCACTCACGCTGCAGGACACCGACTACCCCGGCCAGTACTGGTTTGAAGACAGCGCCCAGGCCCAGCGC
AGCGCGCGCGTGATGATGGAAGCGCTGGAAGTGCGCAGCAGGCAGTTCGACGGCGAAGGCAGCGTGCGCA
CGCTGGCGCCCGGCACGCGCTTCCAGCTGGCCGACCACTACGACCACGGTGACGACGGCGAAGCGCGCTT
TGCCGTGCTGTCCATCCGGCACCAGGCGCGCAACAACTTCAACGAGCGCTTCGGGCAGGTGCTGACGCAG
ACGCTGGGCGCACTGTCCGGCCCCGATGCTCTGGACGGCGCAAGCAACGCGGGCACCGACGCCACGTTCT
ACCGCAACCACTTCACGGTGGTGCGAGACAGCGTGCCATACCGCCCGCCGCGCAGCGATGCGCAGGGGCG
GGCATTGCACCCGCGCCCGACGGTCAACGGCGGCCAGACCGCGCTGGTGGTGGGCAACGGCGGGCCGGTG
CACACCGACCGCGATCACCGCATCAAGGTCCAGTTCCATTGGCAGCGCGGCGCGCGCTCGGCCAGCCGCC
AGCCGCATCCGGCCGGTGACGACAACGCCCGTGCGGATGCCGGCCTGGGCAGCTGGATCCGCGTGGCGGC
GCCGGTGGCGGGCCCCAACTGGGGCGGCGTGGCACTGCCGTGCGTGGGCCAGGAAGTGCTGGTGGAATTC
CTGCAAGGCGATATCGACCGCCCGGTGGTGGTCGGCGCGGCCTACAACGGCACAGGCCAGCGCGACGCGC
AATACAACCAGAACCAGGCCGGCGCGGCGGGCGCCACAGGCAACGCGCCCGCCTGGTTCGCCGGCGACAG
CAAGAGCCAGGGCGCGTACGCCCACAACGCCGTGCTCTCCGGCATCAAGACCCAGGCCCTGGCCGGTAGC
CAGACGGGCGCCTCGGGGGCAGGTCAGAAGAAGGCGGTCCCCCAATCCAACCCGGCGAGCGGCTGCGCAA
GCCCGTCAACGATCGCAAGCCGATGGCATTTCCGCCGGAGGTGA