SecReT6
Protein ID: 300693686
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0679
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]833457..834467 [+]
Producthypothetical protein
NoteTssA
UniProt IDD8N081
KEGG IDrsl:RPSI07_mp0679
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-26, Aligned region: 34..95
ImpA-rel_N [PF06812], Evalue: 1.20E-26, Aligned region: 209..227
Protein Sequence: 336 a.a.     [Download]
>gi|300693686|ref|YP_003749659.1| hypothetical protein RPSI07_mp0679 [Ralstonia solanacearum PSI07]
MLFSTEFDTIQEARRFDDPSLDQGEWVTEIKEADWRAVVAESSALLRTRTKDLRLAAWLTEALSKERGFA
GLREGYELIAGLCEQYWEHLFPLPEPDDPEARTGSMAWLAGRSSQLIREVPLVEAGKGGFSYVDWEVATN
LVESIRRDPDQADELSRGKVTQEQFEVARRASSAAFYTALYNDVVGCGAALLRLESVLDGRAGDHAPSFR
AAREALQAVRALVERFGGKTETKSNAGEPKTTAAPQQTAQPVAEVPSTVIGPIRTRAQALNQLREVAEFF
RQTEPHSPVAYLAARAAKWGDMPLHAWLRTVVKDDATLSQIEELLGLGDPPADNAG
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|300693042|ref|NC_014310.1|:833457-834467 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGCTGTTCTCCACCGAGTTCGACACCATCCAGGAGGCGCGCCGCTTCGACGACCCGTCGCTCGACCAGG
GCGAATGGGTGACCGAGATCAAGGAGGCGGACTGGCGCGCCGTCGTCGCGGAAAGCTCGGCGCTGCTGCG
GACGCGCACCAAAGACCTGCGCCTGGCCGCATGGCTGACCGAGGCGCTGTCCAAGGAGCGCGGCTTTGCC
GGCCTGCGCGAGGGCTACGAGCTGATCGCGGGGCTGTGCGAGCAGTATTGGGAGCATCTCTTCCCGCTGC
CCGAGCCGGATGATCCCGAGGCGCGCACCGGCAGCATGGCGTGGCTGGCGGGGCGTTCCAGCCAGCTGAT
CCGCGAGGTGCCGCTGGTGGAGGCGGGCAAGGGCGGTTTCAGCTATGTCGATTGGGAAGTCGCCACCAAC
CTGGTCGAGTCGATCCGGCGCGATCCGGACCAGGCGGACGAGCTGTCGCGCGGCAAGGTCACGCAGGAGC
AGTTCGAGGTGGCGCGCCGTGCTTCGTCCGCGGCGTTCTATACGGCGCTGTACAACGATGTGGTCGGCTG
CGGGGCGGCGCTGCTGCGGCTGGAGTCCGTGCTGGACGGACGCGCCGGGGACCACGCACCCAGCTTCCGT
GCCGCGCGCGAGGCGTTGCAGGCGGTCCGCGCGTTGGTCGAGCGTTTCGGCGGCAAAACGGAAACCAAGT
CCAATGCGGGCGAGCCCAAGACGACGGCCGCGCCACAGCAGACCGCCCAGCCCGTCGCAGAGGTGCCCAG
CACCGTGATCGGCCCGATCCGCACCCGTGCCCAGGCGCTGAACCAGCTGCGCGAAGTGGCCGAGTTCTTC
CGCCAGACCGAGCCGCACAGCCCGGTGGCCTATCTCGCTGCGCGCGCGGCCAAGTGGGGCGACATGCCGC
TGCACGCGTGGCTGCGCACGGTGGTCAAGGACGATGCGACGCTGTCGCAGATCGAAGAGTTGCTGGGCTT
GGGCGATCCGCCCGCCGATAACGCAGGTTGA