SecReT6
Protein ID: 300697344
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20181
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]885239..888043 [-]
Productconserved protein of unknown function, Rhs element Vgr related protein
NoteTssI
UniProt IDD8P3X2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-63, Aligned region: 46..356
Phage_GPD [PF05954], Evalue: 1.40E-63, Aligned region: 604..628
DUF2345 [PF10106], Evalue: 2.10E-45, Aligned region: 667..819
T6SS_Vgr [PF13296], Evalue: 2.10E-34, Aligned region: 518..628
T6SS_Vgr [PF13296], Evalue: 2.10E-34, Aligned region: 717..737
Phage_base_V [PF04717], Evalue: 4.30E-15, Aligned region: 412..491
Protein Sequence: 934 a.a.     [Download]
>gi|300697344|ref|YP_003748005.1| conserved protein of unknown function, Rhs element Vgr related protein [Ralstonia solanacearum CFBP2957]
MKSLSSLPAAVPQAILGALLGQQTRQITLQTALAADNLVVERFTAREAVSAPFALEVDCLSPSAHLDTAE
LASREATLHLMLADGRRRAWHGYVADCTTLGGDGGLARYRLRIVPWLDRLDGREDCFVYQDKTALEIIED
LFADYPIAQYKLAVGRPCAKRSICCQYRETDYAFMLRLLAEEGLSFRIEHEQGDAPRDGSVQSRHSVVIF
DNDAERPACAQPEIRFHRVDATEREDAIERFSQTRTIGTNAVTVASWDYKALAATTAQASASDPGGELPT
LESFEAAGPYRFADAQGAGRAARLHMQAHEGAYLRYQGQGSVRQIGAGQRFTLTQHFDRRHSAFVTLSVE
HEAANNLGADLARLLGTTAIEAGSYRNRFVAVPAEAPIVPPYRHRPTAPEGQAAVVITDDGTALTTDRDH
RVRIRFPWLRGSAVNAFADPAGNDRSQITAWVRVATASAGPNWGAHHLPRAGTEVLLTFIDGDIDRPLVA
LQQRTEQDALPWPAAEAPLGQALSGWHSQSLGSDGYNQWVVDDHPGQLRTRLASSTASSQLNLGYVVSHG
PTGGERGTWRGTGAELRTDAWAVVRAGAGLLLSTTARAQAGGTLLDAKEARGQFIAAQRTAQRLSDAATS
QQALPLAANEAFDPLTQAFDPAQDGHYPSRVNGQNATQPGNQAPVDKFAQPLLVTESPTSIALTSQATTT
VYAGRHLHGTAQGDWHLAAGNVVAAAAAKGVSLFAQRNGIHAIAEGGPVSIQAHTDALAVLADQAVTVTS
STESVEILAQRNIVLQGGDSVIRMEGRAITFETRKLSVKGAGHPLIGPEGQAAELPALPMGAIPPTTILL
EHTYHDGQGLAGAKYFAKFADGSERQGVLDAQGRATLENVPPGSVQVSYGPMPGAFERKDTAPMPNHDPN
PSDDKIAKLVDKYLSENASQSPTA
 
Nucleotide Sequence: 2805 bp     [Download]
>gi|300696564|ref|NC_014309.1|:c888043-885239 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGAAGTCACTGTCTTCCCTGCCGGCCGCCGTGCCGCAAGCCATCCTGGGCGCGTTGCTCGGGCAGCAGA
CCCGCCAGATCACGCTGCAGACAGCGCTGGCCGCCGACAACCTGGTGGTGGAGCGCTTCACGGCGCGCGA
AGCGGTTTCGGCGCCGTTCGCGCTGGAGGTGGATTGCCTGAGCCCCTCGGCTCACCTCGACACGGCCGAG
CTGGCCTCGCGTGAGGCCACGCTGCACCTGATGCTCGCCGACGGACGGCGCCGCGCCTGGCACGGCTACG
TGGCCGACTGCACGACCCTCGGCGGCGACGGCGGCCTGGCGCGCTACCGGCTGCGCATCGTGCCCTGGCT
CGACCGCCTCGACGGCCGCGAAGACTGCTTCGTCTACCAGGACAAGACCGCGCTGGAGATCATCGAAGAC
CTCTTCGCCGATTACCCCATCGCGCAGTACAAGCTCGCCGTCGGCCGGCCGTGCGCCAAGCGCTCGATCT
GCTGCCAGTATCGCGAGACCGACTACGCCTTCATGCTGCGCCTGCTGGCCGAAGAGGGCCTGTCGTTCCG
CATCGAGCATGAGCAGGGCGACGCGCCGCGCGACGGCAGCGTGCAGTCGCGCCACAGCGTCGTCATTTTC
GACAACGACGCCGAGCGCCCGGCCTGCGCGCAGCCCGAGATCCGCTTCCACCGCGTCGACGCCACCGAGC
GCGAAGACGCCATCGAGCGCTTCTCGCAGACGCGCACGATCGGCACCAACGCCGTGACCGTGGCGTCGTG
GGACTACAAGGCCCTGGCCGCCACCACCGCCCAGGCCAGCGCCAGCGACCCGGGCGGCGAACTGCCCACG
CTCGAATCGTTCGAGGCCGCGGGCCCGTACCGCTTTGCCGATGCCCAGGGCGCCGGCCGCGCCGCCCGGC
TGCACATGCAGGCCCACGAAGGCGCCTACCTGCGTTACCAGGGCCAGGGCAGCGTGCGCCAGATCGGCGC
CGGGCAGCGCTTCACACTCACCCAGCATTTCGACCGCCGCCACAGCGCCTTCGTCACCCTGTCGGTCGAA
CACGAAGCGGCCAACAACCTCGGCGCCGACCTCGCCCGGCTGCTCGGCACCACCGCGATCGAAGCGGGCA
GCTACCGCAACCGCTTCGTCGCCGTGCCGGCCGAGGCGCCGATCGTGCCGCCGTACCGCCACCGCCCCAC
GGCCCCCGAAGGGCAAGCCGCCGTGGTGATCACCGACGACGGCACCGCGCTGACCACCGACCGCGACCAC
CGCGTGCGCATCCGCTTCCCGTGGCTGCGCGGATCCGCGGTCAACGCCTTCGCCGACCCGGCCGGCAACG
ACCGCTCGCAGATCACCGCCTGGGTGCGCGTGGCGACCGCCAGCGCCGGCCCGAACTGGGGCGCCCATCA
CCTGCCGCGCGCCGGCACCGAGGTGCTGCTGACCTTCATCGACGGCGACATCGACCGCCCGCTGGTCGCC
CTGCAGCAGCGCACCGAGCAGGACGCCCTGCCCTGGCCCGCCGCCGAGGCCCCGCTGGGGCAAGCGCTGT
CCGGCTGGCACTCGCAGAGCCTGGGCAGCGACGGCTACAACCAATGGGTGGTCGACGATCACCCCGGCCA
GTTGCGCACGCGGCTGGCCAGCTCCACCGCCAGCAGCCAGCTCAACCTCGGCTACGTGGTCTCGCACGGC
CCGACCGGCGGCGAACGCGGCACCTGGCGCGGCACCGGCGCCGAGTTGCGCACCGATGCGTGGGCGGTGG
TGCGCGCCGGCGCCGGCCTGCTGCTGTCCACCACGGCGCGGGCCCAGGCCGGCGGCACGCTGCTCGACGC
CAAGGAAGCTCGCGGCCAGTTCATCGCCGCCCAGCGCACCGCGCAGCGCTTGTCCGACGCAGCGACCAGC
CAGCAGGCGCTGCCGCTGGCGGCCAACGAGGCATTCGATCCGCTCACGCAGGCGTTCGACCCGGCCCAGG
ACGGGCACTACCCGAGCCGCGTCAACGGCCAGAACGCCACCCAGCCGGGCAACCAGGCACCGGTCGACAA
ATTCGCGCAGCCGCTGCTGGTGACCGAATCGCCCACCAGCATCGCACTGACCTCGCAGGCCACGACCACG
GTCTACGCGGGGCGGCACCTGCACGGCACGGCACAGGGCGACTGGCACCTGGCCGCCGGCAACGTGGTCG
CAGCCGCCGCCGCCAAGGGCGTGAGCCTGTTTGCGCAGCGCAACGGCATCCACGCCATCGCCGAAGGCGG
GCCGGTGTCGATCCAGGCGCATACCGACGCACTGGCGGTGCTGGCCGATCAAGCGGTGACGGTGACCTCG
TCGACGGAGTCGGTGGAGATCCTGGCGCAGCGGAACATCGTGCTGCAGGGTGGGGATTCGGTGATCCGGA
TGGAGGGGCGTGCCATTACCTTTGAGACGCGGAAGCTGTCGGTGAAGGGGGCGGGGCATCCGTTGATTGG
GCCGGAGGGGCAGGCGGCGGAGTTGCCGGCGTTGCCGATGGGGGCGATTCCCCCAACAACGATCTTGCTC
GAACACACTTACCACGACGGCCAGGGTCTGGCTGGCGCAAAGTACTTCGCCAAATTCGCCGATGGATCGG
AACGGCAAGGCGTGCTGGACGCACAAGGGCGAGCAACGCTTGAAAACGTGCCGCCCGGCAGCGTGCAGGT
CAGCTATGGTCCGATGCCCGGCGCTTTCGAGCGCAAGGACACGGCCCCTATGCCCAATCACGATCCAAAT
CCGTCAGACGACAAGATCGCCAAGCTGGTCGACAAATACCTGTCGGAAAATGCTTCGCAAAGCCCGACCG
CTTAA