SecReT6
Protein ID: 300697346
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20183
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]888889..890235 [-]
Producthypothetical protein
NoteTssK
UniProt IDD8P3X4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|300697346|ref|YP_003748007.1| conserved protein of unknown function [Ralstonia solanacearum CFBP2957]
MSYSAKILWGEGLFLRPQHFQRQDAYHESRLHATAQMIQPYGWGIRHAQFDTDALASGVLRATGLSLFFP
DGELYFAPQADTLPPPLVLDAIPAGISELTFHLALYPLQDSGGNYREQPEGGTVSRFVSTEAETADLFTE
AESASITYLKKSVKLVAESEPRDQFISLPVVRVRRTGTGGFELDDTFVPPSLSINASSVLYQRLRRLLDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTANAAFAALSHLYHHPDLHPERLFQEVLRLAGALMT
FTKTYTLADLPAYDHDDPGPVFSRLDTIVRELLDTVISTRYFAIALEETRPSFHLGRIDSGKIDDKTSFY
LSVSADMPAAELVEAIPARFKVGAPDDVDKLVLSSMPGVPLTYTPQVPPAIPVRPGACYFAVESRGMLYE
RMLQAQTITIYAPAGIRELKLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|300696564|ref|NC_014309.1|:c890235-888889 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
GTGAGCTATTCCGCCAAAATCCTCTGGGGCGAAGGGCTGTTCCTGCGACCCCAGCACTTCCAGCGCCAGG
ACGCGTACCACGAATCCCGCCTGCATGCGACGGCGCAGATGATCCAGCCGTACGGATGGGGCATCCGCCA
CGCGCAGTTCGACACCGACGCCCTCGCCAGCGGCGTGCTGCGCGCGACCGGGCTGTCGCTGTTCTTTCCG
GACGGCGAGCTGTACTTCGCGCCGCAGGCCGACACCCTGCCGCCGCCGCTCGTGCTGGATGCGATCCCGG
CCGGCATCTCGGAGCTGACCTTCCACCTCGCGCTCTATCCGCTGCAGGACAGCGGCGGCAACTACCGCGA
GCAGCCGGAGGGCGGCACGGTGTCGCGCTTCGTCTCCACCGAGGCGGAGACAGCGGATCTGTTCACCGAA
GCCGAATCCGCGTCCATCACCTACCTCAAGAAGTCGGTGAAGCTGGTGGCGGAAAGCGAGCCGCGCGACC
AGTTCATCTCGCTGCCCGTCGTGCGGGTGCGCCGCACCGGCACCGGGGGCTTCGAGCTGGACGACACCTT
CGTCCCGCCGAGCCTGTCGATCAATGCGTCGTCCGTGCTGTACCAGCGCCTGCGCCGGCTGCTGGACGCG
CTGCAGGCCAAGGTCAACGCGCTGTATGGCTTTCATCGCGAGCCGACCAAGAACATCATCGAATTCCGCT
CGGGCGATATCGCATCGTTCTGGCTGCTGCACACGGCCAATGCCGCCTTCGCGGCGCTGTCGCATCTCTA
TCACCACCCGGACCTGCATCCGGAGCGGCTGTTCCAGGAGGTGCTGCGCCTGGCCGGCGCACTGATGACG
TTCACCAAGACCTACACCCTGGCCGACCTGCCGGCCTACGACCACGACGACCCCGGCCCGGTGTTCTCCC
GGCTGGACACCATCGTGCGCGAACTGCTCGATACCGTGATCTCGACGCGCTACTTCGCGATCGCGCTGGA
GGAGACGCGACCGTCGTTCCACCTCGGCCGGATCGACTCCGGCAAGATCGACGACAAGACCAGCTTCTAC
CTGTCGGTGTCGGCCGACATGCCGGCGGCGGAGCTGGTGGAGGCGATTCCCGCGCGCTTCAAGGTCGGCG
CGCCGGACGACGTGGACAAGCTCGTGCTGTCGTCCATGCCGGGCGTGCCGCTCACCTATACGCCACAGGT
GCCGCCCGCCATTCCGGTGCGTCCGGGCGCGTGCTACTTCGCGGTCGAATCGCGCGGCATGCTGTACGAG
CGCATGCTGCAGGCCCAGACCATCACCATCTATGCCCCGGCCGGCATCCGGGAACTCAAACTTGAACTCA
TCGCGGTGACTTCATGA