SecReT6
Protein ID: 300697347
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20184
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]890290..890916 [-]
Productconserved exported protein of unknown function
NoteTssJ
UniProt IDD8P3X5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-37, Aligned region: 19..178
Protein Sequence: 208 a.a.     [Download]
>gi|300697347|ref|YP_003748008.1| conserved exported protein of unknown function [Ralstonia solanacearum CFBP2957]
MPDRVATGLKRAFAGMAVVALTACSTGASVLAGAASGALEAVGLKTSSVPDAQKPPREVPLKLTAGANLN
AATDRRPVALVVRLYALKDPTSFLQAPYDTFIDPAREKQTLGADLVQVREMTLIPGQRYEFSEKVSREAS
TLGVVALFRSPAAQRWKFAFNAEKNEKSGIMIGLHACAMTLTTGTPTTPAGSAPLSDLNLLSPANCGG
 
Nucleotide Sequence: 627 bp     [Download]
>gi|300696564|ref|NC_014309.1|:c890916-890290 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGCCGGACCGCGTCGCGACCGGACTCAAGCGGGCGTTTGCCGGGATGGCCGTGGTCGCCCTGACCGCCT
GCTCGACCGGCGCCAGCGTGCTGGCGGGCGCCGCCAGCGGCGCGCTGGAGGCGGTGGGACTGAAGACGTC
GAGTGTGCCGGACGCGCAGAAACCGCCCCGCGAGGTTCCGCTCAAGCTGACCGCAGGCGCCAACCTGAAC
GCGGCGACGGACCGGCGCCCGGTCGCGCTGGTGGTCCGGTTATATGCCCTGAAGGACCCGACCAGTTTCC
TGCAGGCGCCGTATGACACGTTTATTGATCCGGCGCGCGAAAAACAGACGCTCGGGGCCGATCTGGTCCA
GGTCCGGGAAATGACGCTGATTCCCGGCCAGCGTTATGAATTCTCGGAAAAGGTTTCGCGCGAAGCCAGT
ACACTTGGCGTGGTTGCGCTATTCCGCAGCCCCGCCGCCCAACGGTGGAAATTCGCTTTTAATGCAGAAA
AGAATGAAAAAAGCGGCATCATGATCGGATTGCATGCTTGCGCCATGACCCTGACCACGGGCACGCCGAC
CACGCCCGCGGGCAGCGCACCGCTATCCGACCTGAACCTGCTTTCACCGGCCAACTGCGGCGGCTGA