SecReT6
Protein ID: 300697349
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20186
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]891905..892417 [+]
Productconserved protein of unknown function DUF770
NoteTssB
UniProt IDD8P3X7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.10E-59, Aligned region: 11..163
Protein Sequence: 170 a.a.     [Download]
>gi|300697349|ref|YP_003748010.1| conserved protein of unknown function DUF770 [Ralstonia solanacearum CFBP2957]
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVADLAGQSEVPQPKLRDRKFVNIDRDNF
DDVMSAVEPRAAFQVPNTLTEEGGRFGVDLKFRSLEDFAPEAVVNQIEPLRQLLEARSKLADLRNKLAGN
DKLEDLLSDVLNNTEALQKLGAKKDGGEDA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|300696564|ref|NC_014309.1|:891905-892417 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGGCCAAGAAAGAAAGTGTGCAGAAGCGTTTGCAGAAGGTGCGCCCCCCCCGCGTGCAGCTGACGTACG
ACGTTGAAAAGGGCGACGCGATCGAGCAGAAGGAACTGCCGTTCGTGGTCGGTGTGGTGGCGGACCTGGC
GGGCCAGTCGGAAGTGCCGCAGCCCAAGCTGCGCGACCGCAAGTTCGTCAACATCGATCGCGACAACTTC
GACGACGTCATGTCGGCGGTCGAGCCGCGCGCCGCCTTCCAGGTGCCGAACACGCTGACGGAAGAGGGCG
GGCGTTTCGGCGTCGACCTGAAGTTCCGTTCGCTGGAAGATTTCGCGCCGGAAGCCGTGGTGAACCAGAT
CGAGCCGCTGCGCCAGCTGCTGGAAGCGCGCTCCAAGCTGGCCGACCTGCGCAACAAGCTGGCCGGCAAT
GACAAGCTCGAAGACCTGCTGTCCGACGTGCTGAACAACACCGAGGCGCTGCAGAAACTGGGCGCCAAGA
AGGATGGGGGCGAGGATGCTTGA