SecReT6
Protein ID: 300697350
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20187
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]892398..893900 [+]
Producthypothetical protein
NoteTssC
UniProt IDD8P3X8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.70E-193, Aligned region: 72..495
Protein Sequence: 500 a.a.     [Download]
>gi|300697350|ref|YP_003748011.1| conserved protein of unknown function [Ralstonia solanacearum CFBP2957]
MGARMLDNQSAALAQSAPAAETVNLLDQIVDQSRVAKSDAEHARAKDIIGELVNQVLQGTVVVSDNLSAT
LDARVAELDRLISSQLSAVMHAPEFQKLEGTWRGLSYLVKETQTGTMIKIKVLNATKRDLVRDFKTAIDF
DQSALFKKVYEEEFGTFGGAPFGTLIGDFDVTRQPEDVYFIEQMSHVAAAAHAPFIASSSPELFGLESFA
DLGKPRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPMDGTTVEGFNFVEDVDGTDHSKY
LWCNAAWAFGARLTAAFEDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKNSDYAAFFAAQSVQKPKKYDTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFAS
AKNVETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEVPGKPGTYRSVAFLRPHFQLDELSISLRL
VADLPKPTNS
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|300696564|ref|NC_014309.1|:892398-893900 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGGGGGCGAGGATGCTTGACAACCAATCCGCCGCGCTCGCGCAGAGCGCACCGGCAGCCGAGACCGTCA
ATCTGCTCGACCAGATCGTCGACCAGAGCCGTGTCGCCAAGTCGGATGCCGAGCACGCACGCGCCAAGGA
CATCATCGGCGAACTGGTCAACCAGGTGCTGCAGGGCACGGTGGTGGTGTCCGACAACTTGTCGGCCACG
CTGGATGCCCGCGTGGCCGAGCTGGATCGCCTGATCTCGTCGCAGTTGAGCGCCGTCATGCACGCGCCCG
AATTCCAGAAACTGGAAGGCACGTGGCGCGGCCTGTCGTACCTGGTCAAGGAAACGCAGACCGGCACGAT
GATCAAGATCAAGGTGCTCAACGCCACCAAGCGCGACCTCGTGCGCGACTTCAAGACGGCCATCGATTTC
GATCAGAGCGCGCTGTTCAAGAAGGTGTACGAAGAGGAGTTCGGCACCTTCGGCGGCGCGCCGTTCGGCA
CGCTGATCGGCGATTTCGACGTCACGCGCCAGCCGGAAGACGTGTACTTCATCGAGCAGATGTCGCACGT
GGCCGCGGCCGCGCACGCGCCGTTCATCGCCTCGTCGTCGCCGGAGCTGTTCGGCCTGGAATCGTTTGCC
GACCTGGGCAAGCCGCGTGACCTGGCCAAGGTGTTCGATACGGTCGAGTACGCCAAGTGGAAGTCGTTCC
GCGAGTCGGAGGATTCGCGCTACGTGGGCCTGACGATGCCGCGCTTCCTGGGCCGGCTGCCGTACAACCC
CATGGACGGCACCACCGTCGAGGGCTTCAACTTCGTCGAAGACGTGGACGGCACCGACCACAGCAAATAC
CTGTGGTGCAACGCTGCCTGGGCGTTCGGTGCGCGGCTGACCGCCGCGTTCGAAGACTTCGGCTGGTGCG
CGGCGATCCGCGGGGTGGAAGGCGGCGGGCTGGTCGAAGACCTGCCGACGCATACCTTCAAGACCGACGA
CGGCGAGATCGCGCTCAAGTGCCCGACGGAAATCGCCATCACCGACCGGCGCGAGAAGGAACTGAGCGAC
CTGGGCTTCATCCCGCTCGTGCACTGCAAGAACTCGGACTATGCCGCGTTCTTCGCGGCGCAGTCGGTGC
AGAAACCCAAGAAGTACGACACCGACAGTGCGAACGCCAACGCGGTGCTGTCGGCGCAGCTGCAGTACAT
CTTCTCGGTATCGCGCGTGGCGCACTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCG
GCCAAGAACGTCGAGACTTTCCTCAACCGGTGGATCTCGCAGTACGTCCTGCTGGACGACAACGCGACCC
AGGAGCAGAAGGCGCAGTTTCCGCTGCGCGAAGCCTCGATCCAGGTGTCCGAAGTGCCCGGCAAGCCCGG
TACGTACCGCTCGGTGGCGTTCCTGCGGCCGCACTTCCAGCTCGATGAACTGTCGATCTCGCTGCGGCTG
GTGGCGGACCTGCCCAAGCCAACCAATTCCTGA