SecReT6
Protein ID: 300697352
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20189
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]894553..895026 [+]
Productputative secretion system protein (EvpE-like)
NoteTssE
UniProt IDD8P3Y0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.90E-19, Aligned region: 29..137
Protein Sequence: 157 a.a.     [Download]
>gi|300697352|ref|YP_003748013.1| putative secretion system protein (EvpE-like) [Ralstonia solanacearum CFBP2957]
MKGFEPSLLDKLFDDEPHAPMPTALRQLSLEELKSTVARDIESLLNTRIVFEEDDLEGLPECKQSLLTYG
LNDFAGLSLASFYDRNYICQSLTKAIERHEPRLQSVNVSLEINERATNALCFGISAVLLVGPAREPVSFD
AMLQPSTLRYSVSRGRG
 
Nucleotide Sequence: 474 bp     [Download]
>gi|300696564|ref|NC_014309.1|:894553-895026 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGAAAGGTTTCGAACCCAGCCTGCTCGATAAGCTCTTCGACGACGAGCCGCATGCGCCCATGCCCACGG
CTCTGCGGCAGCTTTCGCTGGAAGAGCTCAAGAGCACGGTGGCACGCGATATCGAGTCCTTGCTCAATAC
GCGCATCGTTTTTGAAGAGGACGACCTGGAAGGCCTGCCCGAATGCAAGCAGTCGCTGCTGACCTACGGG
CTGAACGATTTCGCGGGTCTGAGCCTCGCCAGCTTCTACGATCGCAACTACATCTGCCAGTCGCTCACCA
AGGCGATCGAGCGGCACGAGCCACGGCTGCAGAGCGTCAACGTCTCGCTGGAGATCAACGAGCGGGCGAC
CAACGCGCTGTGCTTCGGTATCAGTGCCGTCCTGCTGGTCGGGCCGGCGCGTGAGCCCGTGAGCTTCGAC
GCGATGCTGCAGCCGTCCACGCTGCGGTATTCCGTCTCGCGCGGGCGCGGCTGA