SecReT6
Protein ID: 300697353
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20190
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]895089..896939 [+]
Productputative Type VI secretion protein (DUF879)
NoteTssF
UniProt IDD8P3Y1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-208, Aligned region: 4..615
Protein Sequence: 616 a.a.     [Download]
>gi|300697353|ref|YP_003748014.1| putative Type VI secretion protein (DUF879) [Ralstonia solanacearum CFBP2957]
MEELLPYYERELAFLRRYSRDFAERYPKIAGRLAMSGDGCDDPHVERMIESFSLLTARVSKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSVVHFDVRGVAAQISAPVLVPRGTFLTSRVVRKVECRFRTAYDVTFAPVRI
AAAAFERAVSAPSAVSLPKGATGAIALTLEYVGERGGFESLPLDRLRVYMDGEPSFVAALGDALFLQTAA
AYVEGERPGVWTRLSGVPLQAVGFTEDEALIDCPPRSHPAYRLLTEHFSFAEKFNFFDIDLAAVRRGLTP
GMPVRRLVLHLVLKDVRSDSHAARLLEGLQADHLRLHCTPVVNLFQQMADPIRIEHTASAYPVVADSRRA
HGFDIYSIDKVHLVRETAAHEEVTEFRPFYSLHHGEEPGQSGHYWIARRNELVAQRSPGFETEISIVDTQ
FDPASPQTDTLSLTVTCTNRDLPSTLAFGQPEGDLSMEGGSIARSITFLRKPTPSMRLGGGRAVQWRLIS
LLALNHLSLVQNGLPTLKEMLRLHDLPHSAISARQVEGIVGLDYAPATRWLAGKPFATFVRGLEIRLTLD
EDAFVGTGLHRFIRVLDHFFGLYVHINSFVQLIAVSRRSGKELVRCAPRSGESILV
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|300696564|ref|NC_014309.1|:895089-896939 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGGAAGAGCTGCTGCCTTATTACGAACGAGAACTGGCCTTCCTGCGCCGGTACTCGCGCGACTTCGCCG
AGCGCTACCCGAAGATCGCCGGCCGCCTCGCCATGTCGGGCGACGGCTGCGACGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCTCGCTGCTGACCGCCCGTGTCAGCAAGAAGCTGGACGACGACTACCCCGAATTC
ACCGAGGCGCTGCTGGAGGTCTTGTACCCCCATTACCTGCGCCCGTTTCCGTCGTGCTCGGTGGTGCATT
TCGACGTGCGCGGCGTAGCAGCGCAGATCAGTGCGCCGGTGCTGGTCCCGCGCGGCACGTTCCTGACCTC
GCGCGTGGTGCGCAAGGTCGAGTGCCGTTTCCGCACCGCTTACGATGTCACCTTCGCGCCGGTGCGGATC
GCCGCGGCTGCGTTCGAGCGCGCCGTGTCCGCGCCGTCGGCGGTCAGCCTGCCCAAGGGGGCGACCGGTG
CGATCGCGCTGACGCTGGAGTACGTCGGCGAGCGCGGTGGCTTCGAGTCCTTGCCGCTCGACCGGCTGCG
TGTCTACATGGACGGCGAGCCCTCGTTCGTGGCCGCGCTGGGCGATGCGCTGTTCCTGCAGACGGCGGCG
GCCTATGTGGAGGGCGAGCGCCCCGGCGTGTGGACCCGCCTGTCCGGCGTGCCGCTGCAAGCGGTCGGCT
TTACGGAAGACGAGGCGCTGATCGATTGCCCGCCGCGCTCGCATCCGGCCTATCGGCTGCTGACCGAGCA
CTTCAGCTTTGCCGAGAAATTCAATTTCTTCGACATCGACCTGGCGGCGGTGCGGCGCGGGTTGACGCCC
GGCATGCCGGTCCGCCGGCTGGTGCTGCACCTGGTTTTGAAGGATGTGCGCAGCGACTCGCATGCCGCCC
GCCTGCTCGAGGGCCTGCAGGCCGACCACCTGCGTCTGCATTGCACGCCGGTGGTCAACCTGTTCCAGCA
GATGGCCGACCCGATCCGCATCGAGCACACGGCCAGCGCCTATCCGGTGGTGGCCGACAGCCGCCGCGCG
CACGGCTTCGATATCTACTCGATCGACAAGGTGCACCTGGTGCGCGAGACCGCCGCCCACGAAGAGGTGA
CCGAGTTCCGCCCGTTCTACTCGCTGCATCACGGCGAGGAGCCCGGGCAGTCGGGCCACTACTGGATCGC
GCGGCGCAACGAGCTGGTGGCGCAGCGCAGCCCCGGCTTCGAGACCGAGATTTCCATCGTCGATACGCAA
TTCGACCCGGCCAGCCCGCAGACCGATACGCTGAGCCTGACCGTCACCTGTACCAACCGCGATCTGCCGT
CCACGCTGGCATTCGGCCAGCCGGAGGGCGACCTGTCGATGGAGGGCGGCTCCATCGCCCGCAGCATCAC
GTTCCTGCGCAAGCCGACGCCGTCGATGCGGCTGGGCGGTGGCCGGGCGGTGCAGTGGCGGTTGATCTCG
CTGCTGGCGCTCAACCATCTGTCGCTGGTGCAGAACGGGCTGCCGACGCTCAAGGAGATGCTGCGCCTGC
ACGATCTGCCGCACAGCGCCATTTCGGCGCGGCAGGTCGAGGGCATCGTCGGCCTGGACTACGCGCCGGC
CACGCGCTGGCTGGCCGGCAAGCCGTTCGCCACCTTCGTGCGGGGGCTGGAGATCCGGCTCACGCTGGAC
GAAGACGCCTTTGTCGGCACGGGCCTGCATCGATTCATCCGCGTGCTGGACCACTTCTTCGGTCTGTACG
TCCACATCAACAGCTTTGTGCAGCTGATCGCGGTATCGCGCCGCAGCGGCAAGGAACTGGTCAGATGCGC
ACCCCGCAGCGGCGAATCGATCCTGGTGTGA