SecReT6
Protein ID: 300697355
SecReT6 ID782
T6SS typei4b
Gene symbolclpB
Locus tagRCFBP_mp20192
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]898039..900765 [+]
ProductChaperone clpB
NoteTssH
UniProt IDD8P3Y3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.60E-43, Aligned region: 232..313
AAA_2 [PF07724], Evalue: 2.60E-43, Aligned region: 638..805
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 232..345
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 643..761
AAA_5 [PF07728], Evalue: 5.20E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 5.20E-13, Aligned region: 643..761
ClpB_D2-small [PF10431], Evalue: 3.50E-12, Aligned region: 386..403
ClpB_D2-small [PF10431], Evalue: 3.50E-12, Aligned region: 814..889
AAA_16 [PF13191], Evalue: 3.80E-10, Aligned region: 209..253
AAA_16 [PF13191], Evalue: 3.80E-10, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 3.80E-10, Aligned region: 612..679
AAA_16 [PF13191], Evalue: 3.80E-10, Aligned region: 709..731
Clp_N [PF02861], Evalue: 2.20E-09, Aligned region: 23..74
Clp_N [PF02861], Evalue: 2.20E-09, Aligned region: 114..124
AAA_22 [PF13401], Evalue: 3.10E-07, Aligned region: 231..318
AAA_22 [PF13401], Evalue: 3.10E-07, Aligned region: 639..663
AAA_22 [PF13401], Evalue: 3.10E-07, Aligned region: 704..736
Sigma54_activat [PF00158], Evalue: 1.80E-06, Aligned region: 211..248
Sigma54_activat [PF00158], Evalue: 1.80E-06, Aligned region: 613..743
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 284..339
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 639..679
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 713..736
AAA_25 [PF13481], Evalue: 3.70E-05, Aligned region: 227..262
AAA_25 [PF13481], Evalue: 3.70E-05, Aligned region: 288..328
AAA_25 [PF13481], Evalue: 3.70E-05, Aligned region: 445..488
AAA_25 [PF13481], Evalue: 3.70E-05, Aligned region: 638..660
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 638..667
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 735..769
AAA_19 [PF13245], Evalue: 9.00E-05, Aligned region: 232..258
AAA_19 [PF13245], Evalue: 9.00E-05, Aligned region: 638..664
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 232..295
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 642..678
IstB_IS21 [PF01695], Evalue: 0.00022, Aligned region: 224..254
IstB_IS21 [PF01695], Evalue: 0.00022, Aligned region: 642..660
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 232..252
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 644..672
NACHT [PF05729], Evalue: 0.0016, Aligned region: 232..318
NACHT [PF05729], Evalue: 0.0016, Aligned region: 643..664
Zeta_toxin [PF06414], Evalue: 0.0019, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.0019, Aligned region: 634..682
T2SE [PF00437], Evalue: 0.0022, Aligned region: 214..249
T2SE [PF00437], Evalue: 0.0022, Aligned region: 628..679
AAA_23 [PF13476], Evalue: 0.0061, Aligned region: 232..248
AAA_23 [PF13476], Evalue: 0.0061, Aligned region: 446..492
AAA_23 [PF13476], Evalue: 0.0061, Aligned region: 639..671
Protein Sequence: 908 a.a.     [Download]
>gi|300697355|ref|YP_003748016.1| Chaperone clpB [Ralstonia solanacearum CFBP2957]
MATPLKTLIAKLNATSRQAAERAASLCMARGNYEVDLEHLFLALLENRRSDFAVAARASGIDLAALQRDL
EAEIARFQTGNTRTPAFSPYLPKLFEHAWLIASLDSQITRIRSGHLLLALLTEPSLSALAERGSRLFGRF
EVERLKHDFERMTAGSDEQEQAVDFADGTAVQTDDGRTAPAAALSSTPALDQFTVDLTQAAREGRIDPVI
GRDAEIRQVVDILMRRRQNNPILTGEAGVGKTAVVEGLALRVAANDVPPPLQGVTLRTLDMGLLQAGASV
KGEFENRLKNVIDEVKKSPKPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVEEPSEPLAAAMLRGMAPLMERHFGVRVLDEAITEAVRLSHRYISGRQLPDKAV
SVLDTACAKVALGQSATPGAIEDDQKALERLLGEIAALQREQSAGAAHDARLDALQAKRTELEQRIAQNT
ERLAQERALVARIQALREARESGAAQAGAQDAEPVAANSDVVAMPAKRGRVAAAPDSPDELAALLAELRA
LQGETPMVPLQVDGHVVSEIVSAWTGIPLGRMVKDELRTVLNLKPLLAARVIGQDHALQAIAQRVRTASA
NLEDPNKPRGVFLFAGPSGVGKTETALALADILYGGERKLVTINMSEYQEAHSVSGLKGSPPGYVGYGEG
GVLTEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGEMDDAEGRPIDFRNTIIILTSNVGSSAIMQAC
LNKPAEELPDADTLAETLRPVLYKTFKPAFLGRTKVVPYYPIADDVLAEIITLKLGRIRDRVAANHKATF
QWDTALVESVLARCTEVDAGARAVDHILNGTLLPEIAEAVLTRMAEGGSVEKIKVSVGKAGEFKYRIN
 
Nucleotide Sequence: 2727 bp     [Download]
>gi|300696564|ref|NC_014309.1|:898039-900765 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGGCCACCCCACTCAAGACCTTGATCGCCAAGCTGAACGCGACCAGCCGGCAGGCCGCCGAGCGCGCGG
CCTCGCTGTGCATGGCGCGCGGCAACTATGAAGTCGACCTGGAGCATCTGTTCCTGGCGCTGCTGGAAAA
CCGCCGCAGCGACTTCGCCGTGGCAGCACGCGCCAGCGGCATCGATCTGGCGGCGCTGCAGCGCGACCTG
GAAGCCGAGATCGCGCGCTTCCAGACCGGCAACACGCGCACGCCGGCGTTCTCGCCGTATCTGCCCAAGC
TGTTCGAGCATGCGTGGCTGATCGCCTCGCTGGATTCGCAGATCACGCGCATCCGCTCGGGCCACCTGTT
GCTCGCGCTGCTGACCGAGCCCAGCCTGTCGGCACTGGCCGAGCGCGGCTCGCGGCTGTTCGGCCGCTTC
GAGGTGGAGCGGCTCAAGCACGATTTCGAGCGCATGACCGCGGGCTCGGACGAGCAGGAGCAGGCCGTCG
ATTTCGCCGACGGTACGGCTGTGCAGACGGATGACGGCCGCACCGCGCCCGCCGCCGCGCTGAGCTCGAC
GCCGGCCCTCGACCAGTTCACCGTGGACCTGACGCAGGCCGCCCGCGAAGGCCGCATCGACCCCGTGATC
GGGCGCGACGCCGAGATCCGCCAGGTGGTCGACATCCTGATGCGCCGGCGCCAGAACAACCCGATCCTGA
CCGGCGAGGCCGGCGTCGGCAAGACCGCCGTGGTGGAGGGCCTCGCGCTGCGCGTGGCCGCCAACGATGT
GCCGCCGCCGCTGCAGGGCGTCACGCTGCGCACGCTCGACATGGGCCTGCTGCAGGCCGGTGCGAGCGTG
AAGGGCGAATTCGAGAACCGTCTGAAGAACGTGATCGACGAGGTCAAGAAGAGCCCGAAGCCGATCATCC
TGTTTATCGACGAGGCACACACCATCATCGGCGCGGGCGGGCAGGCCGGCCAGAACGATGCGGCCAACCT
GCTCAAGCCGGCGCTGGCGCGCGGGGAGCTGCGCACCATCGCCGCGACCACATGGAGCGAGTACAAGAAG
TACTTCGAAAAGGACGCCGCCCTCGCACGCCGCTTCCAGGTCGTCAAGGTCGAAGAGCCCAGCGAGCCGC
TGGCCGCGGCCATGCTGCGCGGCATGGCGCCGCTGATGGAGCGCCACTTCGGGGTGCGCGTGCTGGACGA
GGCCATCACCGAGGCCGTGCGCCTGTCGCATCGCTACATCAGCGGGCGCCAACTGCCGGACAAGGCCGTC
AGCGTGCTGGACACGGCGTGCGCCAAGGTGGCCCTGGGCCAGAGCGCCACGCCGGGCGCCATCGAAGACG
ACCAGAAAGCGCTGGAGCGCCTGCTGGGCGAGATCGCCGCGCTGCAGCGCGAGCAGAGCGCCGGCGCCGC
GCACGATGCCCGCCTGGACGCGCTGCAGGCCAAGCGGACCGAGCTGGAACAGCGCATCGCGCAGAACACC
GAGCGCCTGGCCCAGGAGCGCGCACTGGTGGCGCGCATCCAGGCGCTGCGCGAGGCCCGTGAAAGCGGTG
CCGCGCAAGCCGGTGCGCAGGACGCGGAGCCGGTGGCGGCCAACAGTGACGTGGTCGCGATGCCGGCCAA
GCGCGGCCGTGTCGCCGCCGCGCCGGACTCGCCGGACGAACTGGCCGCGCTGCTCGCCGAGCTGCGCGCG
CTGCAGGGCGAAACGCCCATGGTGCCGCTGCAGGTGGACGGCCATGTGGTGTCGGAGATCGTCTCGGCCT
GGACCGGCATTCCGCTGGGCCGCATGGTCAAGGACGAACTGCGCACCGTACTCAACCTCAAGCCGCTGCT
GGCTGCGCGCGTGATCGGCCAGGACCACGCGCTGCAGGCCATCGCCCAGCGCGTGCGCACCGCCTCGGCC
AACCTGGAAGACCCGAACAAGCCGCGCGGCGTGTTCCTGTTCGCCGGCCCATCCGGCGTGGGCAAGACCG
AGACCGCGCTGGCGCTGGCCGACATCCTCTACGGCGGCGAGCGCAAGCTCGTCACCATCAACATGAGCGA
GTACCAGGAGGCGCACAGCGTCTCGGGCCTGAAGGGCTCGCCGCCGGGCTACGTGGGCTACGGCGAGGGC
GGCGTGCTGACCGAAGCGGTGCGCCGCAACCCGTACAGCGTGGTGCTGCTGGACGAAGTCGAGAAAGCCC
ACCCCGACGTGCTGGAGATGTTCTTCCAGGTGTTCGACAAGGGCGAGATGGACGACGCCGAAGGCCGCCC
CATCGACTTCCGCAACACCATCATCATCCTGACCTCGAACGTGGGTTCGTCGGCCATCATGCAGGCCTGC
CTGAACAAGCCGGCCGAGGAACTGCCCGATGCCGACACCCTGGCCGAGACGCTGCGGCCGGTGCTGTACA
AGACCTTCAAGCCGGCCTTCCTGGGGCGGACCAAGGTGGTGCCGTACTACCCGATCGCCGACGACGTGCT
GGCCGAGATCATCACGCTCAAGCTGGGCCGCATCCGCGACCGCGTGGCCGCCAACCACAAGGCCACGTTC
CAGTGGGACACCGCGCTGGTGGAATCCGTGCTGGCCCGCTGCACCGAAGTGGATGCGGGCGCGCGCGCGG
TCGACCACATCCTCAACGGCACGCTGCTGCCCGAGATCGCCGAAGCGGTGCTCACGCGCATGGCCGAAGG
CGGCAGCGTCGAGAAGATCAAGGTCAGCGTCGGCAAGGCCGGCGAGTTCAAGTACCGCATCAACTGA