SecReT6
Protein ID: 300697370
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20210
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]921756..922835 [+]
Producthypothetical protein
NoteTssA
UniProt IDD8P400
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.70E-26, Aligned region: 56..117
ImpA-rel_N [PF06812], Evalue: 1.70E-26, Aligned region: 225..249
Protein Sequence: 359 a.a.     [Download]
>gi|300697370|ref|YP_003748031.1| conserved protein of unknown function [Ralstonia solanacearum CFBP2957]
MATLQLDQLLAPLSGPTPCGEDMVFSSEFDAIQEARRFDDPSLDQGEWVTEIKEADWRAVVAESTALLQT
RTKDLRLAAWLTEALSKERGFTGLREGYELIAGLCEQYWEHLFPLPEPDDPEARTGSMAWLAGRSSQLIR
EVSLVDAGKGGFSYVDWEVATNLVEAIRRDPDQADELSRGKVTQEQFESARRATPAAFYTTLHSDVVGCG
AALLRLESVLDARAADHAPSFRAAREALQAVRALVERFGGRTETKPNANGAKTPAAPQQTAQPVAEAEPD
AMIGPIRTRAQALNQLREVAEFFRQTEPHSPVAYLAARAAKWGDMPLHAWLRTVVKDDATLSQIEELLGL
GDPPADSAN
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|300696564|ref|NC_014309.1|:921756-922835 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGGCAACCCTCCAGCTCGACCAGCTTCTCGCCCCGCTCTCCGGCCCCACGCCTTGCGGCGAGGACATGG
TGTTCTCCTCCGAATTCGACGCCATCCAGGAAGCGCGCCGCTTCGACGACCCCTCGCTCGACCAGGGTGA
GTGGGTGACCGAGATCAAGGAGGCGGACTGGCGCGCCGTCGTCGCGGAAAGCACGGCGCTGCTGCAGACG
CGTACCAAAGACCTGCGCCTGGCCGCATGGCTGACCGAGGCCCTGTCCAAGGAGCGCGGCTTTACCGGCC
TGCGTGAGGGCTACGAACTGATCGCGGGCTTGTGCGAGCAGTACTGGGAGCACCTCTTCCCGCTGCCCGA
GCCGGACGACCCCGAGGCGCGCACCGGCAGCATGGCGTGGCTGGCGGGGCGCTCCAGCCAGTTGATCCGC
GAGGTGTCGCTGGTGGATGCGGGCAAGGGCGGCTTCAGCTATGTCGATTGGGAAGTCGCCACCAATCTGG
TCGAGGCGATCCGGCGCGATCCGGACCAGGCGGATGAGCTGTCGCGCGGCAAGGTTACGCAGGAGCAGTT
CGAATCGGCGCGGCGCGCCACGCCGGCGGCGTTCTACACGACTTTGCATAGCGACGTGGTCGGTTGCGGC
GCGGCGCTGCTGCGGCTGGAGTCCGTGCTGGATGCCCGCGCCGCAGATCACGCGCCCAGCTTCCGCGCGG
CGCGCGAGGCGCTGCAGGCGGTGCGCGCCCTGGTCGAGCGCTTCGGCGGCAGGACGGAGACCAAGCCGAA
TGCGAACGGGGCCAAGACGCCCGCCGCGCCGCAGCAGACCGCCCAGCCCGTCGCCGAGGCCGAGCCCGAC
GCCATGATCGGCCCGATCCGCACCCGCGCCCAGGCGCTGAACCAACTGCGCGAGGTGGCCGAGTTCTTCC
GCCAGACCGAGCCGCACAGCCCGGTGGCTTACCTTGCCGCGCGCGCGGCCAAGTGGGGCGACATGCCGCT
GCATGCCTGGCTGCGCACGGTGGTCAAGGACGATGCGACGCTGTCGCAGATCGAGGAGCTGCTGGGGTTG
GGCGATCCGCCCGCCGACAGCGCGAACTGA