SecReT6
Protein ID: 300697378
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20218
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]932327..933253 [+]
Producthypothetical protein
NoteTssI
UniProt IDD8P408
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-13, Aligned region: 134..208
Protein Sequence: 308 a.a.     [Download]
>gi|300697378|ref|YP_003748039.1| protein of unknown function [Ralstonia solanacearum CFBP2957]
MPICWRHCWRRILRIPAKPPIRRITGGSNRSSHSPRCERVGRKRGYRRGIASFTSRVHAGFTKPPVMRSQ
FRTANGRNDSSPEPLRPRPPPVRAGRRGPDQXTGSGSLAGPCVXPSCPNGAWWRSGQCPHRARWFIGQRV
TWSPRWPADEARRTGLIRQPSSLGRRSLARYRLTVVPWFWLATQQRHSQVFQNRPLRXIFEQVLSPYEPY
ASCASPRRRRPHGRVRHASPPHPVPRDRLSLRHPPAGRSRPGLHHRRRRAGAQRPHAADLRRQPPAGRRR
RIRCRRRHPLPPRAQPGRTRRHPATDLP
 
Nucleotide Sequence: 927 bp     [Download]
>gi|300696564|ref|NC_014309.1|:932327-933253 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGCCGATCTGCTGGCGGCATTGCTGGCGCCGCATCCTGCGAATACCGGCAAAACCCCCAATCCGCCGAA
TCACGGGGGGCAGTAACCGGTCGTCGCATTCGCCACGCTGCGAGCGTGTCGGGCGAAAGCGAGGCTATCG
GCGCGGTATCGCGTCATTCACATCACGCGTACACGCCGGCTTCACGAAACCGCCCGTGATGCGCTCGCAG
TTTCGGACAGCGAATGGACGTAACGACTCTTCTCCAGAACCTCTTCGCCCCCGCCCGCCGCCTGTACGCG
CTGGAAGGCGAGGGCCCGATCAGGNAACTGGCAGTGGAAGCCTGGCTGGGCCGTGCGTGANTCCGAGCTG
TCCGAATGGCGCGTGGTGGCGGTCAGGCCAATGCCCGCATCGTGCTCGATGGTTCATCGGTCAGCGCGTG
ACGTGGTCACCACGCTGGCCGGCGGACGAGGCCCGGCGCACCGGCCTGATCCGCCAGCCGAGCAGCTTGG
GCCGACGCAGTCTCGCGCGCTATCGCCTCACCGTGGTGCCGTGGTTCTGGCTCGCCACCCAGCAGCGCCA
CAGCCAGGTGTTCCAGAACCGGCCGTTGCGGNACATCTTCGAGCAGGTGCTGTCGCCGTACGAGCCCTAC
GCCTCATGCGCTTCGCCGCGGCGCCGAAGACCGCATGGCCGCGTTCGGCACGCGTCGCCGCCTCACCCAG
TTCCGCGAGACCGACTATCACTTCGTCACCCGCCTGCTGGCCGAAGCCGGCCTGGGCTTCACCACCGTCG
AAGACGAGCAGGCGCCCAGCGGCCACACGCTGCTGATCTTCGCCGACAGCCGCCGGCTGGCCGAAGACGC
CGAATCCGCTGCCGACGGCGGCATCCGCTACCACCGCGCGCACAGCCAGGAAGAACGCGACGCCATCCAG
CAACTGATCTGCCATAG