SecReT6
Protein ID: 300697379
SecReT6 ID782
T6SS typei4b
Gene symbol-
Locus tagRCFBP_mp20219
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]932991..934655 [+]
Producthypothetical protein
NoteTssI
UniProt IDD8P409
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.90E-29, Aligned region: 7..203
Phage_GPD [PF05954], Evalue: 6.90E-29, Aligned region: 277..308
Phage_GPD [PF05954], Evalue: 6.90E-29, Aligned region: 456..496
Phage_base_V [PF04717], Evalue: 2.60E-18, Aligned region: 299..396
T6SS_Vgr [PF13296], Evalue: 9.90E-08, Aligned region: 16..44
T6SS_Vgr [PF13296], Evalue: 9.90E-08, Aligned region: 486..514
Protein Sequence: 554 a.a.     [Download]
>gi|300697379|ref|YP_003748040.1| conserved protein of unknown function [Ralstonia solanacearum CFBP2957]
MAAFGTRRRLTQFRETDYHFVTRLLAEAGLGFTTVEDEQAPSGHTLLIFADSRRLAEDAESAADGGIRYH
RAHSQEERDAIQQLICHSRVSIDGVAVSAWDAEAKRSVRGHAPARFGGGMGCPDAYLSISPSLAPDRANA
QRIAEQAMESVEARSRLFIGRGTVRTLRSGTRLKVVDCPHLPRDVDGPYPLLMDLVEHCGINNLTADTQA
TLGQKLGGLEAALTFDTPPSPPESGPGSFGFTRQDEPTERLTPTGELLAAARAHGYAGQFRACDARRPWR
AVVSHTHSSRLYSAPTVKGVHSAIVVGPNGQTEAGGDGEHHTNPRGQIRVRLPWQQGERADDRSTGWVPV
AQRQAGASMGWQWLPRIGQEVLLKCLEDDIDQMVVIGALYNGRGEGGLAPTPAGEPQGPDPAQSGVALPP
GRRQPPSAQANLAAPKPGLARHGHRPRRPPQXRALSGFKXPEHGGRATANCLRRQRRATAHATGHHAAYS
QLNLGHLIHQQDNRRGSFRGQGFEPAHPTATAPCVGRRACWSPPTATRSAARPCRPGTTRPASR
 
Nucleotide Sequence: 1665 bp     [Download]
>gi|300696564|ref|NC_014309.1|:932991-934655 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGGCCGCGTTCGGCACGCGTCGCCGCCTCACCCAGTTCCGCGAGACCGACTATCACTTCGTCACCCGCC
TGCTGGCCGAAGCCGGCCTGGGCTTCACCACCGTCGAAGACGAGCAGGCGCCCAGCGGCCACACGCTGCT
GATCTTCGCCGACAGCCGCCGGCTGGCCGAAGACGCCGAATCCGCTGCCGACGGCGGCATCCGCTACCAC
CGCGCGCACAGCCAGGAAGAACGCGACGCCATCCAGCAACTGATCTGCCATAGCCGGGTCAGCATCGACG
GCGTGGCGGTATCGGCCTGGGACGCCGAAGCCAAGCGCAGCGTGCGCGGCCATGCGCCGGCCCGTTTCGG
CGGCGGCATGGGCTGCCCGGACGCCTATCTGTCGATCAGCCCGTCGCTGGCGCCGGACCGGGCCAACGCC
CAGCGCATCGCCGAGCAGGCGATGGAGAGCGTCGAAGCGCGCTCCCGGTTGTTCATCGGACGCGGCACGG
TGCGCACACTGCGCAGCGGCACGCGGCTGAAGGTGGTCGATTGCCCGCACCTGCCGCGGGACGTGGACGG
CCCGTATCCGTTGCTGATGGACCTGGTGGAGCACTGCGGCATCAACAACCTGACCGCCGATACCCAGGCC
ACACTGGGCCAGAAACTGGGCGGGCTGGAAGCCGCGCTGACTTTCGACACGCCGCCCAGCCCACCCGAAT
CTGGCCCCGGTTCGTTCGGCTTCACGCGGCAGGACGAGCCCACCGAAAGGCTTACCCCCACCGGCGAACT
CCTTGCCGCTGCCCGCGCTCACGGCTACGCCGGCCAGTTCCGCGCCTGCGATGCCCGCCGCCCCTGGCGC
GCGGTGGTGTCGCATACCCATTCGAGCCGCCTGTATTCGGCGCCCACCGTGAAGGGCGTGCACAGCGCCA
TCGTGGTCGGGCCGAACGGCCAGACCGAGGCGGGCGGCGACGGCGAGCATCACACCAATCCGCGCGGCCA
GATCCGCGTGCGCCTGCCGTGGCAGCAGGGCGAGCGGGCGGACGACCGCAGCACGGGCTGGGTGCCGGTC
GCACAGCGGCAAGCCGGCGCCAGCATGGGCTGGCAGTGGCTGCCGCGCATCGGCCAGGAGGTGCTGCTGA
AGTGCCTGGAAGACGATATCGACCAGATGGTGGTGATTGGCGCGCTCTATAACGGCCGGGGCGAAGGGGG
CCTCGCGCCGACGCCGGCGGGCGAGCCCCAAGGGCCAGATCCAGCGCAATCCGGAGTCGCTCTACCACCT
GGGCGACGACAGCCGCCCAGCGCCCAGGCCAACCTCGCCGCGCCAAAGCCCGGCCTGGCACGGCATGGGC
ACCGACCCCGAAGGCCACCGCAACANCGCGCGCTGAGCGGCTTCAAGAGNCCCGAGCACGGCGGGCGCGC
TACAGCCAACTGTCTTCGACGACAGCGACGGGCAACTGCGCACGCAACTGGCCACCACGCAGCCTACAGC
CAGCTCAACCTCGGCCACCTGATCCATCAGCAGGACAACCGGCGCGGCAGCTTCCGGGGCCAGGGCTTCG
AGCCTGCGCACCCGACGGCTACGGCGCCGTGCGTGGGCAGGCGGGCCTGCTGGTCACCACCTACCGCGAC
GCGGTCAGCGGCCAGGCCGTGCCGACCGGGGACAACGCGGCCGGCATCGCGCTGA