SecReT6
Protein ID: 300714993
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04050
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]481593..482090 [+]
Producthypothetical protein
NoteTssB
UniProt IDD8MM52
KEGG IDebi:EbC_04050
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-53, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|300714993|ref|YP_003739796.1| unnamed protein product [Erwinia billingiae Eb661]
MSNSYQNEIPKARVNIKLDVHTGNAQKKMELPLKLLVTGDFSNGQEQRVLSEREKINVNKNNFDSVLAEF
SPALNISVENTLAGDGSEENVRLTFRDMNDFTPEQVARQIPQLNAMLAMRNLLRDLKANLLDNVTFRKEL
ETILKNPALSDELRGELSALAPEKA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|300714588|ref|NC_014306.1|:481593-482090 Erwinia billingiae Eb661 chromosome, complete genome
ATGAGCAACTCTTATCAGAACGAAATTCCAAAAGCGCGAGTAAATATCAAGCTGGATGTTCATACCGGTA
ACGCCCAGAAAAAGATGGAGCTGCCGCTGAAGCTGCTGGTGACCGGCGATTTCAGCAACGGTCAGGAGCA
GCGGGTGCTTTCTGAGCGTGAAAAGATCAACGTCAATAAAAACAACTTCGACAGCGTGCTGGCGGAGTTC
TCCCCGGCACTCAACATCTCGGTAGAAAATACCCTCGCCGGCGACGGCAGCGAAGAGAACGTCAGGCTGA
CCTTCCGCGATATGAACGACTTCACGCCGGAGCAGGTTGCCCGCCAGATCCCGCAACTCAACGCCATGCT
GGCGATGCGCAACCTGCTGCGCGATCTCAAAGCCAACCTGCTGGATAACGTCACCTTCCGCAAGGAGCTG
GAAACCATCCTGAAAAACCCGGCGCTGAGTGACGAATTGCGTGGCGAACTGTCTGCGCTGGCGCCTGAAA
AAGCCTGA