SecReT6
Protein ID: 300714994
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04060
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]482119..483666 [+]
Producthypothetical protein
NoteTssC
UniProt IDD8MM53
KEGG IDebi:EbC_04060
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.30E-173, Aligned region: 90..511
Protein Sequence: 515 a.a.     [Download]
>gi|300714994|ref|YP_003739797.1| unnamed protein product [Erwinia billingiae Eb661]
MLMSVHNETASAGTTTVLDRPVAGGVYASLFEKINLSPVTHLSDLNIWQDNQAMSDASVNERVTAAMKVL
VECLNQSGSTVEKLDKTLLDHHIARLDGQISRQLDAVMHHDAFQQVESLWRGLKSLVDKTDFRQNVKIDV
LDLSKADLLQDFEDAPEIIQSGLYAHTYIAEYDTPGGEPIGALISSYEFDASAQDVALLRNISKVAASAH
MPFIGSAGPQFFLKDNMEDVAAIKDIGNYFDRAEYIKWKAFRETDDARYIGLVMPRVLGRLPYGPDTVPV
RSFNYVEEVKGPDHDKYLWTNASFAFAANMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKI
PSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSTQKPALYDTADATANSRINSRLPYIFLLSRIA
HYLKLIQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGDELQASHPLRDAKVIVEDIEDNPGFFRVRLF
AIPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1548 bp     [Download]
>gi|300714588|ref|NC_014306.1|:482119-483666 Erwinia billingiae Eb661 chromosome, complete genome
ATGCTGATGTCAGTTCACAATGAAACCGCCTCTGCCGGCACCACCACCGTGCTGGATCGCCCCGTTGCGG
GCGGCGTTTATGCCTCACTGTTTGAAAAAATCAATCTCAGCCCGGTCACGCACCTCAGCGACCTGAATAT
CTGGCAGGACAACCAGGCGATGTCCGATGCCAGCGTCAACGAACGCGTCACCGCGGCGATGAAGGTGCTG
GTTGAGTGCCTGAATCAGTCAGGGTCAACGGTTGAAAAGCTCGACAAGACCCTGCTGGACCACCATATCG
CCCGGCTGGACGGGCAGATCAGCCGTCAGCTCGATGCGGTAATGCACCATGACGCGTTCCAGCAGGTGGA
ATCCCTGTGGCGCGGCCTGAAGTCGCTGGTCGATAAAACCGACTTCCGTCAGAACGTGAAGATCGACGTG
CTGGACCTGTCGAAAGCCGACCTGCTGCAGGACTTTGAAGACGCGCCGGAAATCATCCAGAGCGGGCTGT
ACGCACACACCTATATTGCCGAATACGACACTCCCGGCGGCGAGCCGATTGGCGCACTGATCTCCTCCTA
CGAGTTCGACGCCTCGGCGCAGGACGTGGCGCTGCTGCGCAATATCTCTAAAGTCGCGGCTTCCGCGCAT
ATGCCCTTTATCGGCTCCGCCGGCCCGCAGTTCTTCCTGAAGGACAATATGGAAGACGTGGCGGCAATCA
AAGATATCGGCAACTACTTCGACCGCGCCGAATACATCAAGTGGAAGGCGTTCCGCGAAACCGACGACGC
GCGCTATATCGGCCTGGTGATGCCGCGCGTGCTCGGCCGCCTGCCGTACGGCCCGGACACCGTGCCGGTG
CGCAGCTTTAACTACGTTGAAGAGGTGAAAGGCCCGGACCACGACAAATACCTGTGGACCAATGCCTCGT
TCGCCTTTGCCGCCAACATGGTGAAAAGCTTTATCAACAACGGCTGGTGCGTGCAGATCCGCGGTCCGCA
GGCCGGTGGCGCCGTCCAGGATCTGCCGATCCATCTGTACGACCTCGGCACCGGCAATCAGGTGAAAATC
CCGTCTGAGGTGATGATCCCGGAAACCCGCGAGTTTGAGTTCGCTAACCTCGGCTTTATCCCGCTGTCGT
ATTACAAAAACCGCGACTACTCGTGCTTCTTCTCCGCCAACTCGACGCAGAAACCGGCGCTGTACGACAC
CGCAGACGCCACCGCCAACAGCCGCATCAACTCGCGCCTGCCATACATCTTCCTGCTGTCGCGCATTGCA
CACTATCTGAAGCTGATTCAGCGCGAAAACATCGGCACCACCAAGGATCGCCGCCTGCTGGAGCTGGAGC
TGAACACCTGGGTGCGCGGGCTGGTCACGGAAATGACCGATCCGGGCGACGAGTTGCAGGCCTCCCACCC
GCTGCGCGATGCCAAAGTGATTGTCGAAGATATCGAAGACAACCCGGGCTTCTTCCGCGTCAGGCTGTTC
GCCATCCCACATTTCCAGGTGGAAGGCATGGACGTCAACCTGTCTCTAGTTTCCCAGATGCCGAAGGCGA
AAGCGTAA