SecReT6
Protein ID: 300714995
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04070
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]483679..485013 [+]
Producthypothetical protein
NoteTssK
UniProt IDD8MM54
KEGG IDebi:EbC_04070
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.50E-129, Aligned region: 18..441
Protein Sequence: 444 a.a.     [Download]
>gi|300714995|ref|YP_003739798.1| unnamed protein product [Erwinia billingiae Eb661]
MKTEQPLWGRGVMVSPQHFQQQAAYAAWSAECIAQMGLNHPWGVIRAEFEADALKLGRLQARHLHVRFQD
GTLIDTNNVDDLPPVAMPEGHEVIVVLALPLLRANGGNCLQPDDVAERPVRYRQRWRDIRNQFGDDTRQI
AVIKPELTLRFGHQNNGDYLVCPVARLNQDSQGCWTQDETYLPPLLSMQSNHWLLTQLEQLMTQLRARLN
RLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFLRFTQSAPERLYPELARLAGSLLTFSLEHQ
ISAIPVYQHSDLNGVFPPLFNLLSDLLEASLPSRVVSIGLEHDKRLHQWLARLLEPRLREDADFYLSVRS
PLPVAQLQEQFPRQCKVGSPDYVTGLVNSSQQGIPLKPLRHVPAAIPLRLENQYFALDLSHPAAREMLET
GSCMFYVPGMLGEPQLELFAVLRT
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|300714588|ref|NC_014306.1|:483679-485013 Erwinia billingiae Eb661 chromosome, complete genome
ATGAAAACGGAACAACCGCTGTGGGGTCGGGGCGTGATGGTCTCGCCACAGCATTTCCAGCAGCAGGCCG
CGTATGCGGCCTGGTCCGCGGAATGTATCGCACAGATGGGGCTGAATCATCCCTGGGGTGTGATCCGTGC
CGAATTCGAAGCAGACGCCCTTAAATTGGGACGTTTGCAGGCACGGCATCTGCACGTGCGCTTTCAGGAC
GGCACGCTGATCGACACCAATAACGTTGACGATCTGCCGCCGGTAGCGATGCCGGAAGGGCATGAGGTGA
TCGTGGTGCTGGCACTGCCTCTGCTGAGGGCGAACGGCGGCAACTGCCTGCAGCCTGACGACGTTGCCGA
GCGTCCGGTGCGTTATCGGCAGCGCTGGCGGGATATCCGCAATCAGTTTGGTGACGATACGCGACAGATT
GCGGTGATAAAACCTGAGCTGACGCTGCGTTTTGGACATCAGAACAACGGGGATTATCTGGTCTGCCCTG
TAGCACGTCTGAATCAGGACAGTCAGGGCTGCTGGACGCAGGACGAGACTTATCTTCCGCCGCTACTTAG
CATGCAAAGCAACCATTGGCTGCTAACCCAGCTTGAACAGCTGATGACGCAGTTGCGTGCGCGCCTCAAT
CGGTTGATGGCGATGCGACGTGAAAGCAACGAACGTATGGCCGATTTCGCCGTAGCCGATGTGTCGTTGT
TCTGGCTGTTGAATGCGCTCAATAGTGCGGAGCCAGTGCTGGGTCAGTTCCTGCGTTTTACGCAGAGTGC
GCCTGAACGTCTTTACCCAGAGCTTGCCCGTCTGGCTGGAAGCCTGCTGACCTTCTCGTTGGAGCATCAA
ATCAGTGCTATTCCCGTTTATCAACACTCAGATCTTAACGGCGTTTTCCCACCGTTGTTCAATCTGCTAA
GCGATCTTCTGGAAGCCAGCCTGCCGTCGCGCGTGGTGTCGATTGGGCTGGAGCATGATAAACGTCTGCA
TCAATGGCTTGCCCGTCTGTTGGAGCCGCGCCTTCGTGAGGATGCCGATTTCTACCTTTCGGTTCGATCT
CCGCTCCCGGTGGCACAGCTACAGGAACAGTTTCCCCGACAGTGCAAAGTTGGCAGCCCGGATTATGTGA
CCGGACTGGTCAATTCATCACAGCAGGGGATCCCGCTAAAGCCATTACGCCACGTACCCGCCGCGATCCC
TCTCCGTCTGGAAAACCAGTATTTTGCCCTCGACCTGTCGCACCCGGCAGCGCGCGAAATGTTGGAAACC
GGCAGCTGCATGTTTTACGTGCCGGGCATGCTCGGTGAACCTCAACTTGAACTGTTTGCGGTACTGAGAA
CATGA