SecReT6
Protein ID: 300714996
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04080
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]485010..485684 [+]
Producthypothetical protein
NoteTssL
UniProt IDD8MM55
KEGG IDebi:EbC_04080
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.90E-39, Aligned region: 9..211
Protein Sequence: 224 a.a.     [Download]
>gi|300714996|ref|YP_003739799.1| unnamed protein product [Erwinia billingiae Eb661]
MSHRNECDIDALLQNSWLQVISLRHGPKIKEGEGQLLWQRCVSEVEKVQQALKDAGYDTQQSKDVLYAQC
SLIDEVVKGRGAQDDAYVQWLHLPLQGHFLGTVDAGDLLCDRMREVLREPAPEGVVITCFQRVMLLGFLG
GYRSLNDPEREKLVQALNAQVPPFTGPLAQAVLAESKAGFSSSGWLSSWPLRIGFSVLLLVAVWWALNHW
LSSLVCSLLPGAVK
 
Nucleotide Sequence: 675 bp     [Download]
>gi|300714588|ref|NC_014306.1|:485010-485684 Erwinia billingiae Eb661 chromosome, complete genome
ATGAGCCATAGAAACGAGTGTGATATTGACGCGCTGCTGCAAAACAGCTGGTTGCAGGTCATCAGTCTGC
GCCATGGCCCTAAGATTAAGGAGGGAGAAGGCCAGCTATTATGGCAGCGCTGCGTCTCAGAAGTAGAGAA
GGTCCAGCAGGCGCTAAAAGACGCGGGCTACGATACACAACAGAGTAAGGATGTTCTCTATGCCCAATGC
TCGCTGATCGATGAAGTGGTCAAAGGGCGCGGCGCACAGGATGACGCTTACGTCCAATGGCTTCACTTGC
CTCTGCAGGGGCATTTCCTCGGCACGGTTGATGCCGGTGACTTGCTCTGCGACCGCATGCGCGAAGTGCT
GCGCGAGCCGGCTCCGGAAGGGGTTGTTATTACCTGCTTCCAGCGGGTGATGTTGCTGGGTTTCCTCGGT
GGCTACCGCTCCCTGAACGACCCGGAACGCGAAAAGCTGGTACAGGCGCTCAATGCGCAGGTTCCGCCAT
TCACCGGACCCCTGGCGCAGGCAGTACTTGCCGAAAGCAAAGCAGGATTTAGCTCCAGCGGCTGGTTATC
CAGTTGGCCATTGCGCATTGGCTTTTCCGTGCTGTTACTGGTCGCAGTCTGGTGGGCCCTGAACCACTGG
TTGAGTAGCCTGGTTTGTTCGCTGCTGCCGGGAGCGGTTAAATGA