SecReT6
Protein ID: 300714999
SecReT6 ID401
T6SS typei2
Gene symbolclpA
Locus tagEbC_04110
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]488166..490832 [+]
ProductClp ATPase
NoteTssH
UniProt IDD8MM58
KEGG IDebi:EbC_04110
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.30E-39, Aligned region: 240..260
AAA_2 [PF07724], Evalue: 3.30E-39, Aligned region: 614..779
AAA [PF00004], Evalue: 2.90E-19, Aligned region: 242..354
AAA [PF00004], Evalue: 2.90E-19, Aligned region: 619..740
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 242..264
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 332..372
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 618..736
ClpB_D2-small [PF10431], Evalue: 1.80E-12, Aligned region: 387..411
ClpB_D2-small [PF10431], Evalue: 1.80E-12, Aligned region: 785..860
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 142..200
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 219..263
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 287..320
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 481..544
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 600..639
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 682..713
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 757..864
AAA_22 [PF13401], Evalue: 6.20E-08, Aligned region: 241..327
AAA_22 [PF13401], Evalue: 6.20E-08, Aligned region: 507..544
AAA_22 [PF13401], Evalue: 6.20E-08, Aligned region: 615..655
Arch_ATPase [PF01637], Evalue: 1.20E-07, Aligned region: 220..391
Arch_ATPase [PF01637], Evalue: 1.20E-07, Aligned region: 610..629
Arch_ATPase [PF01637], Evalue: 1.20E-07, Aligned region: 688..705
AAA_25 [PF13481], Evalue: 2.30E-06, Aligned region: 242..314
AAA_25 [PF13481], Evalue: 2.30E-06, Aligned region: 481..539
AAA_25 [PF13481], Evalue: 2.30E-06, Aligned region: 614..645
AAA_19 [PF13245], Evalue: 9.40E-06, Aligned region: 135..150
AAA_19 [PF13245], Evalue: 9.40E-06, Aligned region: 239..262
AAA_19 [PF13245], Evalue: 9.40E-06, Aligned region: 550..561
AAA_19 [PF13245], Evalue: 9.40E-06, Aligned region: 612..646
NACHT [PF05729], Evalue: 4.60E-05, Aligned region: 242..328
NACHT [PF05729], Evalue: 4.60E-05, Aligned region: 618..636
Sigma54_activat [PF00158], Evalue: 0.00014, Aligned region: 226..256
Sigma54_activat [PF00158], Evalue: 0.00014, Aligned region: 618..736
Sigma54_activat [PF00158], Evalue: 0.00014, Aligned region: 768..791
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 236..303
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 491..530
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 618..636
Clp_N [PF02861], Evalue: 0.00017, Aligned region: 23..55
Clp_N [PF02861], Evalue: 0.00017, Aligned region: 104..124
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 236..258
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 612..643
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 812..825
AAA_17 [PF13207], Evalue: 0.00027, Aligned region: 242..307
AAA_17 [PF13207], Evalue: 0.00027, Aligned region: 617..653
AAA_17 [PF13207], Evalue: 0.00027, Aligned region: 801..820
Zeta_toxin [PF06414], Evalue: 0.00077, Aligned region: 236..266
Zeta_toxin [PF06414], Evalue: 0.00077, Aligned region: 608..658
Mg_chelatase [PF01078], Evalue: 0.0077, Aligned region: 240..277
Mg_chelatase [PF01078], Evalue: 0.0077, Aligned region: 617..639
AAA_23 [PF13476], Evalue: 0.0087, Aligned region: 242..260
AAA_23 [PF13476], Evalue: 0.0087, Aligned region: 499..540
AAA_23 [PF13476], Evalue: 0.0087, Aligned region: 615..641
Protein Sequence: 888 a.a.     [Download]
>gi|300714999|ref|YP_003739802.1| clpA gene product [Erwinia billingiae Eb661]
MENQSAVLLRRLNPFCARALEAAASLCQTRAHSEVCTEHLLLKLLEQGEGDITVLARRYEWDMDGIWQAL
LGWLDNVPRSVRTRPQLAGPLLALIKQAWLIASLEDDDAHIRSHHLLAALTDKPSLVSCEGLWPLLSLTR
AQLDRLRPLLDAQSDERPEVQQQESLSPSPSTLGDADAPAKKDGGSPAGDALSEALQAALDKFTLDVTAK
ALAGSIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRISEGNVPDSLKTVSVRTLD
LGLLQAGAGVKGEFEQRLKNVIEAVQRSPAPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTI
AATTWSEYKQYFEKDAALERRFQMIKVDEPDDETACLMLRGLKSRYAQHHGVHITDAAVKAAVSLSRRYL
TGRQLPDKAVDLLDTAAARVRMSLDTVPEAITLLNARLTALALEAQALTDDIAAGSAQHDERLRAIAATR
AGLEAQRGQQEAHFAAQQALAQQLMAGRQEQRPQAEIAALQQQLEAQQQQDALIQVDVDTRTVANVIADW
TGVPLSALMKDEQTGLLGLEAEIGRRVVGQDVPLNAIAQRLRAAKTGLTAENGPQGVFLLVGPSGTGKTG
SALALADVLYGGERSLITLNLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAH
RDVLNLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDAIMQLLAENPQATEGDLQELLRPTLRDHFQ
PALLARFQTVIYRPLGAEAMRTIVGMKLDQISQRLARHYGLKTTLGDGLSAALTAACLLPDTGARNIDSL
LNQQVLPVLSQQLLQHMAVKQKPQHLTLDWDDEEGIVLAFDTKKEGEE
 
Nucleotide Sequence: 2667 bp     [Download]
>gi|300714588|ref|NC_014306.1|:488166-490832 Erwinia billingiae Eb661 chromosome, complete genome
ATGGAAAACCAGTCAGCCGTTCTTTTACGTCGTTTAAACCCGTTCTGCGCCCGCGCGCTGGAAGCGGCCG
CTTCGCTGTGCCAGACCCGCGCCCACAGTGAGGTCTGCACTGAGCACCTGCTGCTTAAGCTGCTGGAGCA
GGGCGAGGGCGACATCACCGTGCTGGCCCGGCGCTACGAGTGGGATATGGACGGCATCTGGCAGGCGCTG
CTGGGCTGGCTGGATAACGTGCCGCGCTCGGTCCGCACCCGCCCGCAGCTCGCCGGCCCCCTGCTGGCGC
TGATTAAGCAGGCCTGGCTGATTGCCTCGCTGGAAGATGACGACGCCCACATCCGCAGCCATCACCTGCT
GGCGGCGCTGACGGATAAGCCGTCGCTGGTCAGCTGCGAAGGCCTGTGGCCGCTGCTGAGCCTCACGCGC
GCCCAGCTGGATCGCCTGCGCCCGCTGCTGGACGCGCAGTCCGACGAGCGCCCGGAAGTGCAGCAGCAGG
AGAGCCTGAGCCCGTCGCCTTCAACGCTGGGCGATGCGGATGCTCCGGCTAAAAAGGATGGCGGCAGCCC
GGCCGGCGATGCGCTGAGCGAGGCGCTGCAGGCCGCGCTCGACAAATTCACCCTCGACGTCACCGCCAAA
GCGCTGGCGGGAAGCATCGACCCGGTCTTTGGCCGCGACACGGAAATCCGCCAGATGGTCGACATCCTCT
CGCGCCGCCGCAAGAACAACCCGATTCTGGTCGGCGAACCCGGCGTCGGCAAAACCGCGCTGGTGGAAGG
GCTGGCGCTGCGTATCAGCGAGGGCAACGTGCCCGACAGCCTGAAAACCGTCAGCGTGCGTACCCTCGAC
CTTGGCCTGCTGCAGGCCGGCGCGGGGGTGAAGGGCGAGTTTGAGCAGCGGCTGAAGAATGTGATTGAGG
CCGTGCAGCGGTCGCCGGCGCCGGTGCTGCTGTTTATCGACGAGGCGCACACCATTATCGGCGCGGGCAA
CCAGGCGGGCGGCGCCGACGCCGCCAACCTGCTGAAGCCGGCGCTGGCGCGCGGCGAGCTGCGCACCATC
GCCGCCACCACCTGGAGCGAGTACAAGCAGTATTTCGAGAAGGATGCCGCGCTGGAGCGCCGCTTCCAGA
TGATAAAAGTCGACGAGCCGGACGACGAAACCGCCTGCCTGATGCTGCGCGGCCTGAAGTCGCGCTACGC
GCAGCACCACGGCGTGCATATCACCGATGCCGCGGTGAAAGCGGCGGTCAGCCTGTCGCGACGCTACCTG
ACGGGCCGCCAACTGCCGGACAAGGCGGTGGACCTGCTGGATACCGCCGCCGCGCGGGTGCGCATGAGCC
TCGACACCGTGCCGGAGGCCATCACCCTGCTGAACGCGCGGCTGACCGCGCTGGCTCTGGAAGCGCAGGC
GCTGACGGACGATATCGCCGCCGGCAGCGCGCAGCATGACGAACGCCTGCGCGCCATCGCCGCCACCCGC
GCCGGACTGGAAGCGCAGCGCGGGCAGCAGGAAGCGCATTTCGCCGCGCAGCAGGCGCTGGCGCAGCAGC
TGATGGCCGGCCGCCAGGAACAACGGCCGCAGGCGGAGATTGCCGCGCTTCAGCAGCAGCTGGAAGCCCA
GCAGCAGCAGGACGCGCTGATTCAGGTGGACGTGGATACCCGCACCGTTGCCAACGTGATTGCCGACTGG
ACCGGCGTGCCGCTCTCCGCACTGATGAAGGACGAGCAGACCGGCCTGCTCGGCCTGGAAGCGGAAATCG
GCAGGCGCGTGGTCGGGCAGGACGTGCCGCTGAACGCCATCGCGCAACGGCTGCGCGCCGCCAAAACCGG
GCTGACCGCCGAAAACGGTCCGCAGGGCGTGTTCCTGCTGGTCGGGCCGAGCGGCACCGGCAAAACCGGG
AGCGCGCTGGCGCTGGCCGACGTGCTGTACGGCGGCGAAAGGTCGCTGATCACCCTCAATCTCTCCGAGT
ACCAGGAGCCGCACACCGTCTCGCAGCTGAAGGGTTCGCCTCCGGGCTACGTCGGTTACGGCCAGGGCGG
CATCCTGACCGAAGCGGTGCGTAAGCGGCCTTACAGCGTGGTGCTGCTGGATGAGGTGGAGAAGGCGCAC
CGCGACGTGCTGAACCTGTTCTACCAGGTGTTTGACCGGGGCTTTATGCGCGACGGCGAAGGGCGCGAAA
TCGACTTTCGCAACACGGTTATCCTGATGACCTCAAACCTCGGCAGCGACGCGATTATGCAGCTGCTGGC
GGAAAACCCGCAGGCCACGGAAGGGGATTTGCAGGAGCTGCTGCGCCCGACGCTGCGCGACCACTTCCAG
CCCGCGCTGCTGGCCCGCTTCCAGACCGTTATCTACCGGCCGCTGGGGGCAGAGGCGATGCGCACCATCG
TCGGCATGAAGCTCGACCAGATCAGCCAGCGGCTGGCGCGCCACTATGGCCTGAAAACCACCCTCGGCGA
CGGCCTGTCAGCGGCCCTGACCGCCGCCTGCCTGCTGCCGGACACCGGCGCGCGCAATATCGACAGCCTG
CTGAATCAGCAGGTCCTGCCGGTGCTGAGCCAGCAGCTGTTGCAGCACATGGCCGTGAAACAGAAGCCGC
AGCACCTGACGCTGGACTGGGATGATGAAGAAGGGATTGTTCTGGCGTTCGATACAAAAAAGGAAGGTGA
AGAATGA