SecReT6
Protein ID: 300715000
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04120
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]490829..493330 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDD8MM59
KEGG IDebi:EbC_04120
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-62, Aligned region: 33..355
Phage_GPD [PF05954], Evalue: 3.40E-62, Aligned region: 551..570
DUF2345 [PF10106], Evalue: 1.70E-48, Aligned region: 560..573
DUF2345 [PF10106], Evalue: 1.70E-48, Aligned region: 610..756
T6SS_Vgr [PF13296], Evalue: 3.50E-37, Aligned region: 489..593
Phage_base_V [PF04717], Evalue: 1.30E-16, Aligned region: 76..94
Phage_base_V [PF04717], Evalue: 1.30E-16, Aligned region: 393..482
Sarcoglycan_1 [PF04790], Evalue: 0.00089, Aligned region: 679..726
Protein Sequence: 833 a.a.     [Download]
>gi|300715000|ref|YP_003739803.1| unnamed protein product [Erwinia billingiae Eb661]
MSINPVSFYSHSHHLLAVRNSTSQPDVLAFRGEERLSEPFRWRVEFTSADHAITREAMLMKPASLTLQAP
VDQGWGIRVQQPVRVVQGVVIGFERLSTSADQTHYTVTLQPRLALLSRSRQNAIYQDLSVPQIVEKILRE
RHGMRGQDFVFTLSNEYPRREQVMQYGEDDLAFITRLLGEVGIWFRFTTDTRLQIDVVEFYDGQQGHVKG
LTLPAVPPSGMHDAAVDSVWDLASRFTVVEKSVSGRDYNYRNASVDMNVQVDVTGGDDTTYGESYRWADN
YLAPGDGYSHNPTPESGAFYARLRHERYLNGQTRVAAVTTCPALAPGCELKVSGEEEVSEVFRSGVLVTA
IVSTARRDRSFETAFDGIPLNNRYGFRPVSQPHPVMAGTLPARVTSTTVNDQYGHIDRDGRYRVNMLFDR
AGWETGFESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEHGNPDRPYIAGVLHDSAHGDHVTIRNYKRN
VLRTPKNNKLRLDDTAGQEHIKLSTEYGGKSQLNLGHLVDSEKQKRGEGFELRSDSWGSIRAEKGLLITA
DGQQRAQGQQLEMQAALSQLQQALSQAQALSSAVEEAKAELADIQSQKDLLAESLTELKKSALLLSAPAG
IAQATPASLQLAAGENIISTSGKNTDFSVVKNFTLAAGEAISLFANKMGMKLFASRGKVEIQAQSDEMTL
DALKDIRISSSEGKLLISAKQEIILTSGGGYIRIADGSIECGAPDNIVERATVWQKFAGQSFNVAAQQWS
TSDFAVTPTVLRLSDRSPVARQQLSLKNADGSQSALPTSASGAVDTQNSVSIDSLSATLPKKS
 
Nucleotide Sequence: 2502 bp     [Download]
>gi|300714588|ref|NC_014306.1|:490829-493330 Erwinia billingiae Eb661 chromosome, complete genome
ATGAGCATAAATCCGGTCTCTTTTTATAGCCACAGCCACCACCTGCTGGCGGTCCGCAACAGCACGTCTC
AACCCGACGTGCTGGCCTTCAGGGGTGAAGAACGTCTGAGCGAGCCGTTCAGATGGCGCGTGGAGTTCAC
CAGCGCCGATCACGCCATCACGCGCGAGGCAATGCTAATGAAACCGGCCTCGCTGACCCTGCAGGCTCCG
GTTGATCAGGGCTGGGGCATCAGGGTGCAGCAGCCGGTGCGCGTGGTGCAGGGAGTGGTGATCGGCTTTG
AGCGCCTCAGTACCAGCGCCGATCAGACCCACTATACCGTCACCCTGCAACCGCGGCTGGCGCTACTGTC
GCGCAGCCGTCAGAACGCCATCTATCAGGACCTGTCGGTGCCGCAGATAGTCGAGAAAATCCTGCGTGAG
CGCCACGGGATGCGCGGTCAGGACTTTGTCTTCACGCTGAGCAACGAGTACCCGCGCCGCGAGCAGGTAA
TGCAGTACGGCGAGGACGATCTGGCGTTTATCACCCGATTGCTGGGTGAGGTAGGCATCTGGTTCCGCTT
CACCACCGACACGCGCCTGCAGATCGACGTGGTTGAGTTCTATGACGGTCAGCAGGGCCATGTTAAAGGG
CTGACGCTGCCTGCCGTTCCACCTTCCGGCATGCACGATGCGGCTGTCGATTCGGTGTGGGATCTTGCCA
GCCGCTTTACGGTGGTGGAAAAAAGCGTCAGCGGGCGCGATTACAACTACCGCAACGCCAGCGTAGATAT
GAACGTGCAGGTCGATGTGACTGGCGGTGACGACACCACCTACGGTGAGTCCTATCGCTGGGCGGACAAC
TACCTTGCGCCGGGCGATGGTTACAGCCATAACCCGACTCCGGAGAGTGGGGCTTTCTATGCCCGCCTGC
GTCACGAGCGCTACCTGAACGGCCAGACGCGGGTGGCGGCAGTCACCACTTGTCCGGCGCTGGCCCCTGG
CTGCGAGCTGAAGGTCAGCGGGGAGGAGGAGGTCAGCGAGGTGTTCCGCAGCGGGGTGCTGGTCACCGCC
ATCGTCAGCACTGCGCGGCGCGACCGCAGCTTTGAAACCGCCTTTGACGGTATTCCGCTGAACAATCGCT
ACGGCTTCCGCCCGGTGTCGCAGCCGCATCCCGTGATGGCGGGTACGCTCCCGGCGCGCGTCACCAGTAC
CACCGTCAACGATCAATACGGCCATATCGACCGCGACGGTCGCTACCGCGTCAACATGCTGTTTGACCGT
GCGGGCTGGGAAACAGGCTTTGAAAGCCTGTGGGTTCGTCAGGCGCGTCCCTATGCGGGCGACACATATG
GCCTGCACCTGCCGCTGCTGGCGGGTACTGAAGTGGCCATCGCCTTCGAGCACGGCAACCCGGACCGGCC
ATATATTGCCGGGGTGCTACACGACTCGGCGCATGGCGACCACGTCACCATCCGCAATTACAAACGCAAT
GTGCTGCGCACGCCGAAGAACAACAAATTGCGCCTCGACGACACGGCGGGCCAGGAGCATATCAAGCTCA
GCACCGAATACGGCGGCAAAAGTCAGCTGAATCTCGGTCACCTGGTCGACAGCGAGAAGCAGAAGCGCGG
CGAAGGGTTTGAGCTGCGCAGCGACAGCTGGGGCAGCATCCGTGCAGAAAAGGGGCTACTGATAACGGCA
GATGGCCAGCAAAGGGCGCAGGGCCAGCAGCTGGAGATGCAGGCAGCACTGAGCCAGTTACAGCAGGCGC
TGTCGCAGGCGCAGGCGCTAAGCAGTGCGGTAGAAGAGGCCAAGGCCGAACTGGCAGATATTCAGTCACA
AAAAGACCTGCTGGCAGAGAGTCTGACCGAGCTGAAAAAGTCGGCATTATTACTGAGCGCGCCGGCGGGT
ATTGCCCAGGCTACCCCGGCCAGCCTGCAGCTTGCGGCGGGTGAAAATATTATCAGCACCAGCGGCAAAA
ACACCGACTTTAGCGTAGTGAAAAACTTCACCCTGGCGGCGGGTGAAGCCATCAGTCTGTTTGCAAACAA
GATGGGGATGAAACTCTTTGCCAGCCGGGGAAAAGTGGAAATCCAGGCTCAGAGTGATGAGATGACGCTG
GATGCCCTTAAGGATATCCGTATCTCCAGCAGCGAAGGAAAACTGCTTATCAGTGCGAAGCAGGAAATTA
TCTTAACCAGCGGTGGCGGATATATTCGCATCGCGGACGGATCAATAGAGTGTGGTGCGCCAGACAACAT
CGTTGAGCGTGCGACGGTGTGGCAAAAGTTTGCTGGGCAAAGCTTCAACGTGGCGGCCCAGCAATGGAGT
ACCAGTGATTTTGCGGTAACGCCAACGGTTTTGCGCCTTTCTGACCGCTCTCCCGTGGCGAGGCAGCAGT
TAAGTTTGAAAAATGCAGACGGCAGCCAGTCTGCCCTGCCAACCTCGGCATCGGGGGCGGTGGATACGCA
GAACAGCGTCAGTATTGATTCTCTCAGCGCGACCCTGCCAAAAAAAAGCTAA