SecReT6
Protein ID: 300715007
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04190
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]503893..505647 [+]
Producthypothetical protein
NoteTssF
UniProt IDD8MM66
KEGG IDebi:EbC_04190
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-178, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|300715007|ref|YP_003739810.1| unnamed protein product [Erwinia billingiae Eb661]
MDDLTLRYYDAEMRYLLEAGEEFARAHPDRAALLNLDKSGARDPYVERLFEGFAFMMGRLREKLDDDLPE
LTEGLVTLLWPHYLRTIPSMSVVEFSPDWREMKEKIRIAKGAEVLSRPIGEKSTRCRYTTTQEISLMPLA
LERVSLSTDPDGCSVVCLRFACSSLADWSRVDLSLIPFYFDADAPLACAMHEAFTLNNAGIWLRLPGDPD
RRPLDARFTALGFGEDDGLWPKSNSSFSGYQLLLEYFAFREKFMFTGLRGLENVALPADLPWFEIDVVLG
QRWEHDFTFSEKHLRLHCAPVINLFPLESDPLTLNSLQTEYLLRPMRVQDGHTEIYSVDSVMSSGNHIYV
PFSSFRHKGGMMRHEAPEYYYHSRVRRGASGLHNTWLILGGEAFDNHSVPNEESLSLTLTGTNGQLPRRA
LQSTVLDTAIITNSASVGVRNLCAPTLPCYPPDRDRFHWRVLSHLGSNFLSMMDNAEVLRGTLALYEWTG
SEMNRRRLEAIVDVSHSEIERFEQGYLLRGVQIEVTLDSHGFAGHGDICLFGEMLSHFFALYTDIYLFNR
LVIILQPTGERLEWQEKHNRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|300714588|ref|NC_014306.1|:503893-505647 Erwinia billingiae Eb661 chromosome, complete genome
ATGGACGACTTAACCCTGCGTTATTACGACGCTGAAATGCGCTACTTGCTCGAAGCCGGTGAAGAGTTTG
CCCGTGCCCATCCGGATCGGGCGGCACTGCTGAACCTGGATAAATCAGGTGCGCGCGACCCCTACGTTGA
ACGCCTCTTCGAGGGCTTTGCCTTTATGATGGGGCGCCTGCGCGAAAAGCTCGACGACGACCTGCCTGAG
CTGACGGAAGGGCTGGTCACGCTGCTGTGGCCGCACTATCTGCGCACCATCCCGTCGATGTCGGTGGTGG
AGTTCAGCCCTGACTGGCGTGAAATGAAAGAGAAAATACGGATTGCGAAGGGAGCAGAAGTCCTTTCCCG
GCCGATAGGTGAGAAGTCGACACGTTGCCGTTATACAACGACCCAGGAAATCAGCCTGATGCCGCTGGCG
CTGGAGCGGGTTTCGCTCTCAACCGACCCGGACGGCTGCTCGGTAGTATGCCTGCGCTTTGCCTGCAGCA
GCCTGGCCGACTGGAGCCGTGTGGATCTCAGCCTGATCCCATTCTACTTCGATGCCGACGCGCCGCTGGC
CTGTGCCATGCACGAAGCTTTTACCTTAAACAATGCAGGCATTTGGCTGCGCCTGCCTGGCGACCCGGAT
CGCCGTCCGCTGGATGCGCGCTTTACCGCGTTGGGATTTGGTGAAGACGACGGACTGTGGCCAAAGAGCA
ATAGCAGCTTCAGTGGTTACCAGCTGCTGCTGGAGTACTTTGCCTTTCGCGAGAAGTTTATGTTCACCGG
CCTGCGCGGCCTGGAGAATGTTGCGCTGCCTGCGGATCTGCCGTGGTTCGAAATCGACGTGGTGTTGGGG
CAGCGCTGGGAACATGACTTTACCTTCAGTGAGAAACATCTGCGGTTGCACTGCGCGCCGGTGATCAACC
TCTTTCCACTGGAGTCCGATCCGCTGACGCTAAACTCGCTGCAGACCGAATACCTGCTGCGCCCGATGCG
CGTGCAGGATGGTCATACGGAAATTTATTCCGTTGACTCGGTGATGTCTTCCGGCAATCACATCTATGTA
CCGTTCTCCAGCTTCCGACATAAAGGCGGAATGATGCGCCACGAAGCGCCGGAATATTACTACCATTCCC
GCGTGCGGCGCGGCGCATCAGGGCTGCATAACACCTGGCTGATTCTCGGCGGGGAAGCCTTTGATAACCA
TAGCGTGCCAAATGAAGAAAGCCTGTCGCTGACGCTGACCGGTACCAATGGCCAGTTGCCGCGTCGTGCA
CTGCAGAGCACGGTGCTGGATACCGCGATAATAACCAACTCTGCTAGCGTGGGGGTGCGAAACCTTTGTG
CGCCGACGCTGCCCTGTTATCCGCCGGACCGTGACCGCTTCCACTGGCGGGTGCTGAGCCATCTTGGCAG
CAACTTCCTGTCGATGATGGACAATGCCGAAGTGCTGCGCGGTACGCTGGCCCTGTACGAGTGGACCGGC
AGCGAGATGAACCGCCGCCGCCTGGAAGCGATAGTCGACGTTAGCCACAGCGAAATCGAGCGCTTTGAGC
AGGGCTACCTGCTGCGCGGCGTGCAGATTGAGGTGACGCTCGACAGTCACGGCTTTGCCGGGCACGGGGA
TATCTGCCTGTTCGGCGAGATGCTCAGCCATTTTTTCGCCCTGTACACCGACATCTATCTGTTTAACCGC
CTGGTTATCATTCTGCAACCCACCGGAGAGCGCCTGGAATGGCAAGAGAAACACAACCGCCGCATTCCCG
GCTAA