SecReT6
Protein ID: 300715008
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04200
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]505656..506696 [+]
Producthypothetical protein
NoteTssG
UniProt IDD8MM67
KEGG IDebi:EbC_04200
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.30E-75, Aligned region: 3..305
Protein Sequence: 346 a.a.     [Download]
>gi|300715008|ref|YP_003739811.1| unnamed protein product [Erwinia billingiae Eb661]
MEADLTRMNFYRFCQLLEKQHPDKPPLGSTSHLRDDTVRFSPWPGMGFPAGELKSVEYSEDDVTLAPKVR
TTFMGVYGVDSPLPTAYLDDISQRREGHEELQDFLDIFSHRILTQFYRIWCKYSYPATFESGGTDSISQS
LLGLIGLGIPGTASHIATPVSRFLALLGVLRQPAKTQQGVQAMVRLLAPETRARVSPYCLRPIEINQPLG
FYGEQDFLLDGNTPLGDEVMDTSSQLLIELMTDCEREAQGWKPDGQLYLDFLVMLRVYLGWRFKAKIRLT
VSTALLPVVPLGEAPFWLGMSGVLGVEGKEIPTDIPQTFTTELGSYYGLQPTTHVKGNKRVNYQFD
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|300714588|ref|NC_014306.1|:505656-506696 Erwinia billingiae Eb661 chromosome, complete genome
ATGGAAGCGGACCTGACGCGGATGAACTTTTACCGCTTCTGCCAGCTGCTGGAAAAACAGCACCCGGATA
AACCCCCGCTCGGCAGTACTAGCCACCTGCGAGATGACACTGTGCGCTTCAGCCCGTGGCCGGGTATGGG
TTTTCCTGCCGGCGAGCTGAAAAGCGTGGAGTACAGTGAAGACGATGTCACGTTGGCACCAAAAGTGCGT
ACCACCTTTATGGGCGTCTACGGAGTGGATTCTCCGCTACCGACCGCCTATCTCGACGACATCAGCCAGC
GGCGGGAGGGACACGAGGAGCTGCAGGATTTTCTCGATATCTTCAGCCATCGCATCCTGACGCAGTTCTA
CCGCATCTGGTGTAAATACTCCTATCCGGCCACCTTCGAAAGCGGCGGAACGGACAGCATCTCCCAGTCG
CTGCTCGGGCTGATAGGGCTGGGAATTCCCGGCACTGCCAGCCATATCGCCACTCCGGTTTCGCGCTTTC
TGGCGCTGCTCGGCGTGCTGCGCCAGCCTGCAAAAACCCAGCAGGGCGTGCAGGCAATGGTACGCCTGCT
GGCGCCAGAAACGCGGGCGCGGGTCAGCCCATATTGCCTGCGCCCGATTGAAATCAATCAGCCGCTCGGC
TTCTACGGCGAGCAGGATTTTTTGCTGGATGGCAACACCCCGCTGGGTGATGAAGTGATGGATACCAGCA
GCCAGCTGCTGATTGAATTAATGACCGACTGCGAGCGTGAAGCACAGGGCTGGAAGCCGGACGGTCAGCT
GTATCTGGATTTTCTGGTGATGCTGCGCGTTTATCTCGGCTGGCGTTTTAAAGCGAAAATTCGTCTGACC
GTCAGTACAGCTCTGCTGCCCGTTGTGCCTCTTGGAGAAGCCCCGTTCTGGCTGGGCATGAGCGGGGTAC
TGGGCGTGGAGGGGAAAGAAATCCCCACTGACATCCCGCAGACATTTACCACCGAGCTTGGCAGCTATTA
CGGCCTGCAACCGACCACACATGTAAAAGGAAATAAGCGTGTTAATTACCAGTTTGACTAA