SecReT6
Protein ID: 300715009
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04210
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]506701..507219 [+]
Producttype VI secretion system family protein, lipoprotein VCA0113
NoteTssJ
UniProt IDD8MM68
KEGG IDebi:EbC_04210
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.90E-36, Aligned region: 10..163
Protein Sequence: 172 a.a.     [Download]
>gi|300715009|ref|YP_003739812.1| unnamed protein product [Erwinia billingiae Eb661]
MCWLLPLLAISLTGCGLTQTVSDGTRSAVSSIFYKKIKVLHLDFTAREGLNTDARENHSSPQSLVIRIYQ
LKDSKTFDRLVYQQLATDGDQLLGADLLASRDVVLTPGGAVNLNMPMEQEAQFVAVVALFRQPDLAKKSW
QQVLQREALNPDQPRVLEAADNSLILQPLKDK
 
Nucleotide Sequence: 519 bp     [Download]
>gi|300714588|ref|NC_014306.1|:506701-507219 Erwinia billingiae Eb661 chromosome, complete genome
GTGTGCTGGCTGCTGCCATTGCTTGCCATTAGCCTGACCGGCTGCGGGCTGACGCAGACCGTTTCTGACG
GTACCCGCTCTGCGGTATCGTCTATTTTCTATAAAAAAATTAAGGTGCTGCACCTAGACTTTACTGCGCG
TGAGGGGCTGAATACCGACGCGCGAGAAAACCATTCCAGTCCGCAGTCTTTAGTCATCCGTATTTATCAG
CTGAAAGATAGCAAGACCTTTGACAGGCTGGTCTATCAACAGCTGGCCACCGACGGAGATCAGCTCTTGG
GTGCTGATTTGCTTGCAAGCCGTGACGTGGTGCTGACTCCCGGCGGTGCAGTTAACCTCAATATGCCAAT
GGAGCAAGAAGCGCAGTTTGTTGCCGTAGTGGCGCTATTTCGTCAGCCGGACCTGGCCAAAAAAAGCTGG
CAGCAGGTGCTACAGCGCGAAGCACTGAACCCTGACCAACCCCGGGTGCTGGAAGCGGCCGACAATAGCC
TGATCCTGCAACCGCTCAAGGATAAGTAA