SecReT6
Protein ID: 300715010
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04220
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]507219..507692 [+]
Producttype VI secretion system, lysozyme-related family protein
NoteTssE
UniProt IDD8MM69
KEGG IDebi:EbC_04220
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.80E-16, Aligned region: 31..117
Protein Sequence: 157 a.a.     [Download]
>gi|300715010|ref|YP_003739813.1| unnamed protein product [Erwinia billingiae Eb661]
MPQSHNAPSLYEMLYGNFSGGLELHNVSEENQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTTILQGL
PGTAHQLMTTLSGVLLRYEPRLSSIRVDMLPQTLPGELRYTIDAELKGIGLVRYGTDFMPEGKVLIRHLK
QQQFINPNARKWISGHE
 
Nucleotide Sequence: 474 bp     [Download]
>gi|300714588|ref|NC_014306.1|:507219-507692 Erwinia billingiae Eb661 chromosome, complete genome
ATGCCACAATCCCATAACGCCCCCTCGCTGTATGAAATGCTGTACGGCAATTTCAGCGGCGGGCTGGAGC
TGCATAACGTCAGCGAGGAGAACCAGGTGATCCTCTCGGTGCTCGACAATATGCAGCGCATTCTCAACTG
TCGCGCCGGCACGCTGGCGCATCTGCCCGATTACGGTCTGCCGGATATGACCACCATCCTGCAGGGGTTA
CCCGGTACCGCGCACCAGCTGATGACCACATTGTCCGGCGTGCTGTTGCGCTACGAGCCGCGCCTCAGCA
GCATCCGGGTGGACATGCTACCGCAAACACTCCCCGGCGAACTGCGTTACACCATTGATGCCGAACTCAA
AGGTATCGGCCTGGTGCGCTATGGCACCGACTTTATGCCGGAAGGCAAAGTGCTGATCCGCCATTTGAAA
CAGCAGCAGTTTATTAACCCTAATGCCAGGAAATGGATATCAGGTCATGAATGA