SecReT6
Protein ID: 300715011
SecReT6 ID401
T6SS typei2
Gene symbol-
Locus tagEbC_04230
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]507685..509085 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDD8MM70
KEGG IDebi:EbC_04230
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.00E-48, Aligned region: 28..49
DUF3702 [PF12486], Evalue: 2.00E-48, Aligned region: 109..152
DUF3702 [PF12486], Evalue: 2.00E-48, Aligned region: 313..458
ImpA-rel_N [PF06812], Evalue: 5.80E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 5.80E-20, Aligned region: 351..366
Protein Sequence: 466 a.a.     [Download]
>gi|300715011|ref|YP_003739814.1| unnamed protein product [Erwinia billingiae Eb661]
MNDTPSRKIKTGNDPRTLADYAALRDELNKLSHPARPDVNWHYAEKLCLSLFEQNGVELQTAAWYTLART
QLAGLYGLNEGLSVLEALISHQWGALWPQPVHARMEILSGLSQRIQQLMRTLPLSYSDISQLYRAEQHLT
RLGDVLQRLELKHLSQLDALRSQMHNSAVRLENSDGAAGTGAAIQPGVVLPAPATDGQASWANAPSGRPA
ADIYDRINAVKWVYVAQPEPQPNVAVLTTLPAPAKSWKPFALGVITMLAAGSAALWGWHAFHRPDPLQAQ
LAASLAPLPAILSPAQRDSLRQQASLPPQIAQTQRQLSSLAQLPPGWNIDYGRQLVEQAQILWPEQARPL
VQAWQQQQKANALSAGSLSGWHQGMTKLTQLSERLSRLDEQKGKYMTVSELKSAVFATQQSFNQSIPAEE
QLRALSQTPTGQPLPAAAKAQLEMHLKQLTASYAEIKQNASRGERG
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|300714588|ref|NC_014306.1|:507685-509085 Erwinia billingiae Eb661 chromosome, complete genome
ATGAATGACACCCCCTCCCGTAAAATCAAAACCGGTAACGACCCGCGTACGCTGGCGGATTATGCCGCCC
TGCGTGATGAGCTGAACAAGCTGTCCCACCCTGCGCGGCCCGATGTGAACTGGCACTATGCCGAAAAGTT
GTGTCTTTCGCTGTTTGAGCAAAATGGCGTGGAGCTACAGACGGCGGCCTGGTACACGCTCGCCCGCACG
CAGCTGGCCGGACTGTATGGCCTTAATGAAGGATTGTCTGTCCTGGAGGCATTGATAAGCCATCAGTGGG
GCGCTCTCTGGCCGCAGCCTGTGCACGCCCGCATGGAGATCCTCAGCGGTCTGAGCCAGCGTATCCAGCA
GCTGATGCGCACCTTACCGTTGAGCTACAGCGACATCAGTCAGCTGTATCGTGCCGAGCAGCACCTCACC
CGTCTGGGGGACGTTCTCCAGCGGCTGGAGCTTAAGCATCTGAGCCAGCTTGATGCATTACGTAGCCAGA
TGCATAACAGCGCTGTCCGGCTGGAAAACAGCGATGGCGCCGCTGGCACGGGCGCTGCGATTCAACCCGG
CGTTGTACTGCCCGCACCGGCAACAGACGGCCAGGCAAGCTGGGCTAATGCCCCGTCCGGCCGTCCGGCG
GCAGATATTTATGACCGCATTAACGCGGTTAAGTGGGTGTATGTGGCGCAGCCGGAACCTCAGCCGAATG
TGGCCGTGTTGACGACGCTGCCGGCACCGGCAAAATCCTGGAAGCCGTTTGCGTTGGGGGTGATTACCAT
GCTGGCGGCAGGAAGCGCCGCGCTGTGGGGATGGCATGCTTTCCACCGGCCTGACCCGCTGCAGGCGCAG
CTGGCGGCATCGCTGGCCCCGCTGCCCGCGATTCTTTCTCCCGCCCAGCGGGATAGCCTGCGCCAGCAAG
CGTCGTTACCGCCCCAAATTGCACAAACCCAGCGGCAGCTTTCCAGCCTGGCGCAGTTACCGCCGGGCTG
GAATATCGATTACGGTCGTCAGCTGGTTGAACAGGCGCAGATACTGTGGCCGGAGCAGGCCAGGCCGCTG
GTGCAGGCGTGGCAGCAACAGCAGAAGGCCAATGCGTTGTCAGCCGGGAGCCTGTCTGGCTGGCATCAGG
GTATGACGAAGCTGACGCAACTGAGTGAGCGGCTGAGCAGGCTGGATGAACAGAAGGGAAAATACATGAC
GGTCAGCGAACTGAAATCCGCCGTGTTTGCCACCCAGCAGTCATTTAATCAATCGATACCGGCTGAGGAG
CAGCTACGGGCATTGTCACAAACGCCCACGGGACAGCCTTTGCCAGCTGCAGCTAAAGCGCAGCTGGAGA
TGCATCTGAAGCAGCTAACGGCGAGCTATGCAGAAATTAAGCAGAATGCGTCAAGAGGGGAAAGAGGCTA
A