SecReT6
Protein ID: 300718501
SecReT6 ID403
T6SS typeN/A
Gene symbol-
Locus tagEbC_39260
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]4372900..4374402 [+]
ProductOmpA family protein
NoteTagL
UniProt IDD8MXA0, D8MXA0
KEGG IDebi:EbC_39260
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 6.10E-19, Aligned region: 122..218
Rick_17kDa_Anti [PF05433], Evalue: 0.0009, Aligned region: 36..78
Protein Sequence: 500 a.a.     [Download]
>gi|300718501|ref|YP_003743304.1| unnamed protein product [Erwinia billingiae Eb661]
MERNHLGKISLLTAVVMLSSSCASLHETGQNYGTAIGCIGGAALGGGLTYLLTKDAGKALAGGLAGGIAG
CVAGNAWQNREKALAKIAAEEHIVISSSPLQAQESGGKKDVGIVAQVEDNGMFDTDSAQLSVDGLRQVRK
LAAVMKQDDQQGVVLIVGHTDATGNASWNQKLSESRAQSVGRVLQQAGLNPQRLYFQGAGSSRPIADNAT
LAGRSANRRVEIVGLANEALLKQRVEQEGSNLAYLRYGTQSADSMAKPKATTSSRKTARPAKQTSSSQSR
ASKTDEVASAVESSQTAAATPSSQPTNGKNWVDFGGQPVSRAMQPLAANLKPLSSGFSLISKANASQVTG
SCLTDTARVAGAAKNLASGKAIDTHRTKDYLPNMNGHAWAGLVNNHLVTLSPVQVLQENATVEVNPKVYI
TRNYQSTGNRKVDAPVQAVANAWEGEDSILYRVYMPAADGQPLSCIDLLMPKNAAKAQQGQLFYSSHSNA
YMANYLPVRS
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|300714588|ref|NC_014306.1|:4372900-4374402 Erwinia billingiae Eb661 chromosome, complete genome
GTGGAACGAAATCATTTAGGGAAGATTAGCCTGCTGACGGCCGTCGTTATGCTGTCATCAAGCTGCGCCA
GTCTGCACGAAACGGGTCAAAACTATGGCACGGCCATTGGATGTATTGGTGGCGCGGCACTGGGCGGTGG
GCTGACCTATTTACTCACTAAAGATGCCGGAAAAGCCCTTGCTGGCGGACTGGCCGGTGGGATCGCCGGA
TGCGTAGCGGGCAATGCCTGGCAGAATCGCGAAAAGGCGCTGGCCAAGATTGCTGCTGAAGAACATATCG
TCATCAGCTCGAGCCCGTTACAGGCTCAGGAAAGTGGCGGCAAAAAAGATGTCGGTATCGTCGCCCAGGT
TGAAGATAACGGCATGTTCGATACTGACAGTGCGCAGCTATCGGTTGATGGCTTACGCCAGGTAAGAAAA
CTTGCGGCCGTTATGAAGCAGGACGATCAGCAAGGTGTGGTGCTTATTGTTGGGCATACCGATGCCACCG
GCAACGCCAGCTGGAACCAGAAGCTTTCAGAAAGCCGGGCGCAAAGTGTCGGACGCGTATTACAGCAGGC
AGGTCTGAATCCACAGCGACTTTATTTCCAGGGCGCGGGCTCATCCCGTCCGATAGCTGACAACGCTACC
CTCGCCGGAAGATCGGCAAACCGTCGGGTCGAGATTGTCGGTCTGGCGAATGAAGCCTTGCTGAAACAGC
GTGTTGAGCAGGAAGGCAGCAACCTTGCCTACCTTCGCTACGGCACGCAGTCCGCAGACAGCATGGCAAA
ACCTAAAGCCACCACGTCCTCACGCAAAACGGCGCGTCCGGCAAAACAGACCTCCTCTTCTCAATCCCGT
GCCAGTAAAACCGATGAGGTTGCAAGCGCAGTAGAGTCGAGCCAGACAGCCGCAGCAACCCCTTCTTCAC
AACCCACCAATGGCAAAAACTGGGTTGATTTTGGCGGCCAGCCCGTCAGCCGCGCCATGCAGCCGCTGGC
TGCTAACCTCAAACCGCTCAGCAGTGGCTTCAGCCTGATTTCCAAAGCGAATGCCAGCCAGGTCACCGGC
AGTTGCCTGACCGATACCGCCCGTGTCGCCGGGGCGGCAAAAAATCTTGCCAGCGGCAAAGCGATTGATA
CCCATCGCACCAAAGACTATCTGCCAAATATGAATGGCCATGCCTGGGCCGGGCTGGTCAATAACCATCT
GGTCACCCTTTCGCCAGTCCAGGTATTGCAAGAAAACGCCACGGTGGAAGTTAATCCGAAGGTCTATATC
ACCCGAAACTATCAGTCCACGGGTAACCGCAAGGTTGATGCACCGGTTCAGGCTGTGGCAAATGCGTGGG
AAGGCGAGGACAGCATCCTTTATCGCGTCTATATGCCTGCGGCCGACGGCCAGCCTCTTTCCTGTATCGA
TCTTCTGATGCCAAAAAATGCAGCCAAAGCGCAGCAGGGGCAGCTTTTCTACTCCAGTCACAGCAACGCT
TATATGGCGAACTATCTCCCGGTCCGTAGTTAA