SecReT6
Protein ID: 300718508
SecReT6 ID403
T6SS typeN/A
Gene symbol-
Locus tagEbC_39330
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]4382722..4385220 [+]
Producttype VI secretion system, Rhs element Vgr protein
NoteTssI
UniProt IDD8MXA7
KEGG IDebi:EbC_39330
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 1.60E-40, Aligned region: 588..595
DUF2345 [PF10106], Evalue: 1.60E-40, Aligned region: 609..761
Phage_GPD [PF05954], Evalue: 1.80E-38, Aligned region: 44..352
Phage_GPD [PF05954], Evalue: 1.80E-38, Aligned region: 573..615
T6SS_Vgr [PF13296], Evalue: 3.10E-32, Aligned region: 116..130
T6SS_Vgr [PF13296], Evalue: 3.10E-32, Aligned region: 491..596
Phage_base_V [PF04717], Evalue: 1.90E-13, Aligned region: 409..485
Protein Sequence: 832 a.a.     [Download]
>gi|300718508|ref|YP_003743311.1| unnamed protein product [Erwinia billingiae Eb661]
MSIQEYILAGSKLPIHNHYQLRLTRLESQQPGVDISVLRFSSSEAISDILRYEIEFTSAVKDIPARYIIN
YSALFLMYPDGEPWQAVKPRIIPGVITQLHQFGTSADETRYVATLEHRVTRLNQGCNNAIYQNDSVISMT
ENTFLRYNMDRLDFRFALNDRYPLKKFMMQFGESEYAHIARRLADSGICFFFEYDEENNCDVMVLADHSY
AWPEPLAVPFRHPAGMFDGGLESVWEMSVSRKTIPKSVTVNDDYYPAAQSDMTATTETNADYPALVAEDY
RWGEYYPEPGKEYSNEPGQGMWYARRRQDRHLTEQITFEGKSNCMTLRPGMVITTPGKEWPEAPDGLLIV
STHAKNIARDTAYVITFTAVPLNIQHPYRPALLPWPTVTGTLAARISSAHPDEPYAHINAEGLYRAQFGF
DRTEWQKGFESCWLRLAKPYSGETYGFHMPLLDATGVAIAFENGDVDRPYIAYALHDSRHPDPVALSNHK
RNVIRTPANNKLRLDDTRGKEHIKLSTPASGKSQLNLGALVDDKRKDRGHGAELRTDDWVAVRGGKGVFI
SADVQASAGGQQLDMQQAKALLSSAMVEMQSLSASAQQAQALAADIDRQQTLLQQKLDKLQQAVLLLSAP
NGVGIVSGESMQLYAQDSLTLTAGKQVDIGAAKKFTIAAGDQISLYSRQGTKMFAARGDIDLQAQGGKFT
TWSTDDTHIASGKKMTVSAQDELVLICGGAWIKLKGGNVEIGGPGKMLVKNGGIVKQGATSMQSVMKSFE
PEQFTERFIVTHPLNGKPLASQKYRITLDDGQIIEGVTDASGKTQEIKSNIIKDMIISLIDD
 
Nucleotide Sequence: 2499 bp     [Download]
>gi|300714588|ref|NC_014306.1|:4382722-4385220 Erwinia billingiae Eb661 chromosome, complete genome
ATGAGCATTCAGGAATACATTCTTGCAGGCAGTAAATTACCGATTCACAACCACTATCAGCTCAGGTTAA
CCCGGCTGGAATCTCAGCAGCCCGGCGTCGATATTTCGGTGCTGAGGTTCAGCAGTTCAGAGGCTATCAG
CGATATTCTGCGTTACGAAATAGAGTTTACCAGCGCAGTTAAGGACATCCCCGCCCGTTACATCATTAAC
TACTCCGCCCTGTTCCTGATGTACCCCGACGGCGAACCGTGGCAGGCGGTTAAACCGCGCATCATCCCCG
GCGTCATCACCCAGCTTCACCAGTTCGGTACCTCTGCCGATGAGACCCGTTATGTTGCGACACTGGAACA
CCGCGTCACTCGCTTAAATCAGGGCTGCAATAACGCGATTTACCAGAACGACAGCGTGATCAGCATGACC
GAAAACACCTTCCTGCGTTACAACATGGATCGGCTGGATTTCCGTTTTGCACTCAACGATCGGTACCCGC
TGAAGAAATTCATGATGCAGTTTGGTGAAAGTGAGTACGCACACATTGCGCGCCGCCTGGCCGACAGCGG
CATCTGTTTTTTCTTCGAATATGACGAAGAAAACAACTGCGATGTGATGGTGCTGGCCGATCACTCTTAC
GCCTGGCCTGAACCGCTTGCTGTTCCGTTCCGCCACCCGGCTGGCATGTTTGACGGTGGACTGGAATCGG
TCTGGGAGATGTCGGTCAGCCGTAAAACCATCCCGAAGTCGGTGACGGTCAACGACGACTATTATCCCGC
CGCGCAAAGCGATATGACCGCCACAACGGAGACCAATGCGGACTATCCGGCGCTGGTTGCCGAAGATTAT
CGCTGGGGTGAGTATTATCCCGAGCCGGGCAAGGAGTACAGCAACGAGCCCGGTCAGGGCATGTGGTATG
CCAGACGTCGACAGGATCGCCACCTCACTGAGCAAATCACCTTTGAGGGCAAGTCCAACTGCATGACACT
GCGTCCGGGGATGGTCATCACCACGCCCGGTAAGGAGTGGCCGGAAGCACCGGATGGCCTGCTGATTGTG
TCCACCCACGCCAAAAATATCGCCCGCGATACGGCGTATGTCATCACCTTCACCGCCGTTCCGCTCAACA
TCCAGCATCCGTATCGTCCTGCCCTGCTGCCGTGGCCAACCGTCACCGGCACGCTGGCTGCCCGCATCTC
CAGCGCCCATCCCGATGAGCCTTATGCCCACATCAACGCCGAAGGTCTGTATCGCGCGCAGTTTGGCTTC
GACCGCACCGAATGGCAGAAAGGCTTTGAGAGTTGCTGGCTGCGCCTGGCGAAGCCTTATTCCGGCGAAA
CCTACGGCTTCCATATGCCGCTGCTAGATGCCACCGGCGTGGCGATTGCGTTCGAAAACGGCGACGTTGA
CCGGCCTTACATCGCCTATGCGCTGCATGATTCGCGCCATCCTGACCCTGTTGCGTTATCGAACCATAAG
CGGAATGTGATTCGTACACCGGCCAATAACAAGCTGCGGCTGGACGACACGCGCGGCAAAGAGCACATCA
AGCTTTCGACGCCTGCCAGCGGTAAGAGTCAGCTGAACCTCGGCGCGCTGGTTGATGATAAGCGTAAGGA
TCGCGGGCACGGCGCTGAGCTGCGCACCGATGACTGGGTGGCGGTTCGCGGCGGCAAAGGCGTGTTTATT
TCTGCCGATGTGCAGGCATCCGCCGGAGGTCAGCAGCTGGACATGCAACAGGCAAAGGCACTGCTTTCCA
GCGCGATGGTGGAAATGCAGAGCCTGTCGGCCAGCGCGCAACAGGCGCAGGCATTAGCCGCCGACATCGA
CCGGCAGCAGACGCTGTTACAGCAAAAACTCGACAAGCTTCAGCAGGCCGTTTTACTGCTCAGCGCACCA
AATGGCGTTGGAATTGTCAGCGGTGAAAGCATGCAGCTGTATGCGCAAGACAGCCTGACGCTGACCGCCG
GTAAACAGGTAGATATTGGCGCGGCCAAAAAATTCACCATCGCGGCCGGCGATCAAATCAGCCTGTACAG
CCGTCAGGGCACCAAAATGTTTGCCGCCAGGGGTGACATCGACCTTCAGGCGCAGGGTGGGAAATTCACT
ACCTGGTCCACGGATGACACGCATATTGCCAGCGGTAAGAAAATGACGGTATCAGCGCAGGACGAGCTGG
TTCTGATTTGCGGCGGTGCCTGGATCAAGCTGAAAGGCGGCAATGTCGAGATAGGCGGGCCGGGGAAAAT
GCTGGTGAAGAATGGCGGTATTGTAAAACAAGGCGCGACCAGCATGCAGAGCGTGATGAAGTCGTTCGAG
CCTGAACAATTCACAGAAAGATTTATTGTCACTCATCCCCTCAACGGCAAACCACTGGCTTCCCAAAAAT
ACAGAATCACGCTGGACGATGGTCAGATAATTGAGGGGGTAACTGACGCCTCAGGGAAAACCCAGGAAAT
AAAATCCAATATCATTAAAGACATGATTATCAGCTTGATTGACGATTAA