SecReT6
Protein ID: 300718512
SecReT6 ID403
T6SS typeN/A
Gene symbol-
Locus tagEbC_39370
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]4389096..4389353 [+]
Producthypothetical protein
NotePAAR
UniProt IDD8MXB1
KEGG IDebi:EbC_39370
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.80E-19, Aligned region: 8..78
Protein Sequence: 85 a.a.     [Download]
>gi|300718512|ref|YP_003743315.1| unnamed protein product [Erwinia billingiae Eb661]
MKNVVVLGDKTSHGGTVISASSTFEIVGKYAALLNDSVSCPEHGPNRIIECDSSYEELGKGIVVHGCKTE
CGSMVLASLPDVGFA
 
Nucleotide Sequence: 258 bp     [Download]
>gi|300714588|ref|NC_014306.1|:4389096-4389353 Erwinia billingiae Eb661 chromosome, complete genome
ATGAAAAATGTTGTGGTGCTTGGGGATAAAACTTCCCATGGCGGTACGGTCATCTCGGCGTCTTCCACCT
TCGAAATAGTGGGTAAATACGCGGCATTGCTAAATGACAGTGTGAGCTGCCCAGAGCATGGCCCAAACCG
CATTATCGAATGCGATTCCAGTTATGAGGAGTTGGGAAAAGGCATTGTGGTGCATGGTTGTAAAACCGAG
TGCGGGTCGATGGTGTTAGCCAGCTTGCCTGATGTGGGGTTTGCATAA