SecReT6
Protein ID: 300718515
SecReT6 ID403
T6SS typeN/A
Gene symbol-
Locus tagEbC_39400
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]4393907..4395682 [+]
Producttype VI secretion protein, VCA0110 family
NoteTssF
UniProt IDD8MXB4
KEGG IDebi:EbC_39400
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-119, Aligned region: 5..588
Protein Sequence: 591 a.a.     [Download]
>gi|300718515|ref|YP_003743318.1| unnamed protein product [Erwinia billingiae Eb661]
MEDDFLKYFDGEMRYLKEAGLEFSQAFPELGRTLGLDGSPVPRDESVERLFQGFSLMMAKLRQKIDDDIP
ELTEPLLSHLLPVINRTLPSIAVVELMPAAPELHVREEVLPAESELYTQPLGNDQQRCAYRTVRDLKLHP
FALDSVAVFTLQEGQQALRLRFTLPALTEIRPADWQNISLYLNGDRVLQSALYLALSRQVKGIGVRFWQN
ATDLMPVDATFMPRWQAEADASLWPESDSPALCGEVRPWLEYFTAPERYFFMQLQGLETLTFPPDTTSFD
IEVTLSERWPYDLSVPPDALRMHCVPVINLFRLLAQPLAVTTAVSDYRLRPHRLKDGHTEIYAVNDVVQV
TEDNTEFSYVPYSHFRHKGGMLKYAKSWPERYYHTRLYRGPSGLNETILTLGGRTHAEQNGVKMRLNMTC
TSGAYPRMALQASVYDGDMAPSNLELKCATRTRPSMPYYPLTDALYQWQVLSLLHPQAIAGLMEIGTLRH
ALGLLDWTNSAGNARRIAGITHVEYDPSHYPAEGWHGVAIRITLDETQFCGQGDALLFSEVLEQFYTQYA
DIRRFTQLTVTLSHSGRQWVWPERRLTRILF
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|300714588|ref|NC_014306.1|:4393907-4395682 Erwinia billingiae Eb661 chromosome, complete genome
ATGGAAGACGATTTCTTAAAATATTTTGACGGCGAGATGCGCTATCTGAAGGAGGCCGGGCTGGAGTTCT
CGCAGGCGTTTCCGGAACTGGGCCGCACGTTGGGTCTGGACGGCAGTCCGGTTCCGCGCGATGAATCCGT
GGAGCGGCTGTTTCAGGGCTTTTCGCTAATGATGGCAAAACTGCGGCAGAAGATTGATGACGATATTCCC
GAACTGACTGAACCGCTGCTCTCGCATCTGCTGCCGGTGATCAACCGCACCCTGCCCTCGATCGCGGTTG
TCGAACTGATGCCCGCCGCGCCAGAACTGCATGTGCGCGAGGAAGTGCTGCCTGCTGAAAGCGAACTTTA
TACCCAGCCGCTGGGCAATGACCAACAGCGCTGCGCCTATCGCACGGTCCGCGACCTGAAGCTACATCCG
TTTGCGCTAGATAGCGTTGCGGTATTCACCCTGCAGGAAGGTCAGCAGGCGCTGCGGCTGCGCTTCACCC
TGCCCGCTCTCACCGAAATCCGCCCTGCCGACTGGCAGAACATCAGCCTGTATCTCAATGGAGATCGCGT
GCTGCAGTCTGCGCTGTATCTCGCGCTCAGCCGTCAGGTGAAAGGCATAGGCGTGCGGTTCTGGCAGAAC
GCGACCGACCTGATGCCGGTAGATGCGACGTTTATGCCGCGCTGGCAGGCTGAAGCCGACGCCTCACTGT
GGCCCGAGAGCGACAGCCCGGCGCTGTGCGGCGAAGTGAGACCGTGGCTGGAGTATTTTACCGCGCCGGA
ACGTTATTTCTTTATGCAGTTGCAGGGACTGGAGACCCTGACTTTCCCGCCGGATACCACGTCGTTTGAT
ATTGAGGTGACGCTCAGCGAACGCTGGCCGTATGATTTGTCGGTGCCTCCGGACGCCCTCCGCATGCACT
GCGTGCCGGTGATCAACCTGTTCCGCCTGCTGGCGCAGCCGCTGGCCGTGACCACCGCGGTCAGCGATTA
CCGGCTGCGGCCGCACCGCCTGAAAGACGGCCATACCGAGATCTATGCGGTGAATGACGTGGTGCAAGTG
ACCGAAGACAACACCGAATTCAGCTACGTCCCCTACAGCCATTTCCGTCATAAAGGCGGCATGCTGAAAT
ATGCCAAAAGCTGGCCCGAACGTTATTACCACACCCGCCTGTATCGTGGACCTTCCGGGCTGAATGAAAC
CATTCTGACGCTGGGTGGCCGGACGCATGCAGAACAAAACGGTGTGAAGATGCGCCTGAACATGACCTGC
ACCAGCGGCGCATACCCGCGCATGGCGTTGCAGGCCAGCGTATACGACGGCGACATGGCCCCTAGCAACC
TTGAGCTGAAGTGTGCCACCCGCACGCGCCCTTCGATGCCGTATTACCCGCTGACAGACGCACTTTATCA
GTGGCAGGTGCTGTCGCTGCTGCATCCGCAGGCCATCGCCGGGCTGATGGAGATTGGCACGCTGCGTCAC
GCGCTTGGTTTGCTGGACTGGACAAACAGTGCAGGTAACGCCCGCCGCATCGCGGGCATTACGCATGTTG
AATACGATCCCTCACATTACCCTGCCGAAGGCTGGCACGGCGTGGCGATCCGCATCACGCTGGATGAAAC
GCAGTTCTGCGGACAGGGGGACGCCCTGCTATTCAGTGAGGTGCTGGAACAGTTTTACACCCAGTACGCC
GATATCCGACGCTTCACGCAGCTGACGGTGACGCTCAGTCATTCCGGCAGACAATGGGTTTGGCCCGAGC
GACGCTTAACACGGATTTTGTTCTGA