SecReT6
Protein ID: 300718516
SecReT6 ID403
T6SS typeN/A
Gene symbol-
Locus tagEbC_39410
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]4395682..4396707 [+]
Producthypothetical protein
NoteTssG
UniProt IDD8MXB5
KEGG IDebi:EbC_39410
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.50E-75, Aligned region: 21..318
Protein Sequence: 341 a.a.     [Download]
>gi|300718516|ref|YP_003743319.1| unnamed protein product [Erwinia billingiae Eb661]
MTMGDNEKRLNAFWRDKDGNDRAHAFNFYRFCQLLEKQLSDLKPIGSTFSPKNDAVRFRPHPGMGFPVSE
LKAVETDPERPDAPPTVRTTFMGLYGVDSPLPTGYIDDIAQKREGHEAQEAFLDIFNHRMMTQFYRIWRK
YSYPATFEDGGTDKTSRSLMALTGITDRCDVSASRLLAILQPLVLTTRTEEGIASVIRSQAPNTQVVVKP
HKVTQMPVGKRARFSISDRQRLGDHLVLGSMMSDANYCIGVEMFTEDANEAKGWLPGGQLREDVFTLLRV
YLGCDYDASLELTIPMRLAPVPRLGERSLLMGYNVVLGLREDNLGEMAERVTMRVGRIRKK
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|300714588|ref|NC_014306.1|:4395682-4396707 Erwinia billingiae Eb661 chromosome, complete genome
ATGACGATGGGAGATAACGAGAAGCGCCTGAACGCATTCTGGCGCGACAAGGACGGCAACGACCGGGCGC
ACGCATTTAACTTCTATCGCTTCTGCCAGCTTTTGGAGAAACAGCTGTCGGACCTGAAACCCATCGGCAG
TACTTTCTCGCCGAAAAATGACGCTGTGCGCTTTCGCCCGCATCCGGGCATGGGTTTTCCGGTCAGCGAG
CTTAAGGCGGTGGAAACCGATCCCGAACGACCCGATGCCCCGCCGACGGTACGCACCACCTTTATGGGGC
TGTACGGCGTGGATTCGCCACTGCCGACGGGCTACATCGATGACATCGCCCAAAAGCGAGAAGGCCACGA
GGCGCAGGAAGCCTTTCTGGACATCTTTAACCACCGGATGATGACGCAGTTCTACCGCATCTGGCGAAAG
TACAGCTACCCCGCCACCTTTGAAGACGGCGGTACTGACAAAACCTCTCGCAGCCTGATGGCCCTGACCG
GCATCACCGACAGGTGCGACGTTTCCGCCTCGCGACTGCTGGCAATACTTCAACCGCTGGTCCTAACCAC
CCGCACGGAAGAAGGCATTGCCAGCGTGATCCGCTCGCAGGCCCCGAATACGCAGGTTGTCGTGAAGCCG
CATAAGGTAACGCAGATGCCCGTCGGGAAGCGGGCCAGATTCTCGATTTCAGATCGGCAAAGGTTGGGCG
ATCACTTAGTGCTTGGCAGCATGATGTCCGATGCCAACTACTGCATTGGCGTGGAGATGTTTACCGAGGA
TGCGAACGAGGCCAAAGGCTGGCTTCCCGGCGGGCAGCTTAGGGAAGACGTATTTACTTTGCTGCGGGTG
TATTTGGGGTGTGATTACGACGCGAGTTTGGAGCTGACCATTCCGATGAGGTTAGCTCCGGTGCCACGGC
TGGGGGAGCGGTCGCTGCTAATGGGGTATAACGTGGTGCTGGGGTTGAGGGAGGATAATTTGGGGGAGAT
GGCTGAGAGGGTGACGATGAGGGTTGGGAGAATTCGGAAAAAATGA