SecReT6
Protein ID: 300723431
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2515
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2463286..2465448 [+]
Producthypothetical protein
NoteTssI
UniProt IDD3VHC8
KEGG IDxne:XNC1_2515
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-59, Aligned region: 24..327
Phage_GPD [PF05954], Evalue: 1.10E-59, Aligned region: 526..563
Phage_base_V [PF04717], Evalue: 2.20E-25, Aligned region: 377..469
Protein Sequence: 720 a.a.     [Download]
>gi|300723431|ref|YP_003712736.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MERKFIAHTSSSGKSLYFKSLKGTERLSEVYEFEVQLLSESRLDDPLSLHNTVLTVEIKNKSLPTRYLSG
DIEKISYAPFYKYDDKLYLYTATVKPKLCNLKHKLGYSIWQNKTVPDIIAAVLKNAGISFESQLTEGYRE
WEYCVKHNETDFDFIHRLMEHEGIYYYFKHDMGAHTLILVDAPQSHDPMPGYDKIKYINTHDSLKKKGLI
EYIYDWNVSSITIPYTYSFDDYDFRKPRAKLYAAAQTAINSIVDDSEIFIWPGHYVKTAQGQFYAKVRQQ
ASEAKSELIDGKGNVLGMAPGHTFTLVLPNDINGDDHNDYFITGTHYFFYETPYIACSAEHLFDKQEDKN
IVQFEAIPADTPWKPPAVTPWPKITGLETAVVAGPKDKKIWTDKYGRIKVKFRWDKDDKQDDTRSCWIRV
ATYWAGWQYGNICIPRVGEEVIISFINGDPDKPLVVGSTYNHENMPPWELPKYETRVGIMSNTKGGKHDQ
ANYLFLDDEPDKESFDLHAERDMNISVEKDKKVTIDGNRTTEIKKEQKDTVKGNASFTYNANHETTIDKK
DKLTVKGGQQEAIKSGRKTEIDGGDTYKLTGDLNAKIDGNWIQDITGTTKISSPNLITIKSDTNVIIDCP
QTFWSAKLLSISFLAAGISITGTSVSQTTNSSSLTGTSMSTTLVDINNITTSLNNTVTKIDKASIALGNS
DVSIAKSNANISNSSLHIIS
 
Nucleotide Sequence: 2163 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2463286-2465448 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGGAAAGAAAATTTATCGCCCATACTTCATCATCAGGAAAATCTTTATATTTCAAATCACTAAAAGGGA
CAGAAAGATTATCAGAAGTTTATGAGTTCGAAGTGCAATTATTGAGTGAAAGCAGATTAGATGACCCATT
ATCCCTGCATAATACAGTGCTAACGGTAGAAATAAAAAACAAGTCACTACCAACAAGATATTTAAGTGGT
GATATAGAAAAGATATCCTATGCCCCCTTCTATAAATATGACGATAAACTCTATTTATATACGGCCACAG
TAAAACCTAAGCTCTGTAATTTAAAACACAAATTAGGTTACAGTATTTGGCAAAATAAAACGGTACCCGA
TATTATTGCAGCCGTATTGAAAAATGCAGGAATTTCCTTTGAAAGTCAGCTTACTGAAGGTTATCGTGAA
TGGGAATATTGCGTCAAACATAATGAAACTGATTTCGATTTTATCCATCGATTGATGGAGCATGAAGGCA
TTTATTATTATTTTAAACACGATATGGGAGCACATACCCTCATTTTGGTTGATGCTCCCCAATCCCATGA
TCCTATGCCCGGATATGATAAGATTAAATATATCAATACACATGATTCATTGAAAAAAAAAGGACTCATA
GAATATATTTATGACTGGAACGTCTCCAGTATTACCATACCCTACACCTATAGCTTTGATGATTATGATT
TTCGCAAACCACGCGCAAAATTGTACGCGGCAGCGCAAACGGCTATCAACTCCATTGTTGATGATTCAGA
AATCTTCATCTGGCCCGGCCACTATGTAAAAACAGCTCAAGGGCAGTTTTATGCCAAAGTGCGTCAGCAA
GCCTCAGAAGCAAAAAGCGAACTGATTGATGGCAAAGGAAATGTACTGGGAATGGCACCAGGGCATACTT
TTACGCTTGTGCTTCCCAATGATATCAATGGCGATGACCACAATGATTATTTCATCACAGGAACACACTA
TTTTTTTTACGAAACACCTTACATAGCCTGCTCCGCTGAGCATCTGTTTGATAAACAGGAAGATAAAAAC
ATCGTGCAATTTGAGGCGATTCCCGCCGATACACCCTGGAAACCCCCGGCTGTGACACCCTGGCCAAAAA
TCACCGGCCTTGAAACCGCCGTCGTCGCTGGCCCGAAAGACAAAAAAATCTGGACGGATAAATACGGACG
GATAAAAGTAAAATTCCGTTGGGATAAAGATGACAAACAAGATGATACCCGTTCTTGCTGGATACGTGTT
GCAACCTATTGGGCTGGCTGGCAGTACGGTAACATATGTATTCCCCGTGTAGGCGAAGAAGTCATTATCA
GTTTCATCAATGGTGATCCTGATAAACCTTTAGTTGTCGGCAGTACTTATAACCATGAGAATATGCCGCC
TTGGGAATTGCCCAAATATGAAACCCGCGTCGGCATTATGTCAAACACAAAAGGGGGCAAACACGATCAG
GCAAATTACCTTTTTTTGGATGATGAACCTGATAAAGAATCATTTGATTTACATGCCGAACGTGACATGA
ATATCTCAGTGGAAAAAGATAAAAAAGTCACCATTGATGGAAATCGCACAACTGAAATAAAAAAAGAACA
AAAAGACACAGTAAAAGGCAATGCCAGTTTCACTTATAACGCAAACCATGAAACCACCATTGATAAAAAA
GACAAATTAACGGTCAAAGGTGGTCAGCAAGAAGCCATCAAAAGCGGGCGGAAAACAGAAATTGATGGCG
GAGACACTTATAAACTTACAGGCGATCTGAACGCAAAAATTGATGGAAACTGGATTCAAGACATTACAGG
AACAACCAAAATTTCAAGCCCTAATCTTATTACAATAAAAAGCGACACCAACGTGATAATCGACTGCCCG
CAGACTTTTTGGTCAGCTAAACTGTTATCTATTTCCTTCCTGGCCGCCGGCATCAGCATAACCGGAACAT
CCGTCTCCCAGACAACAAATAGCAGCAGTCTGACCGGAACCAGCATGTCAACCACGTTAGTTGACATCAA
TAACATTACGACATCCCTCAATAACACAGTGACAAAAATTGATAAGGCATCTATAGCATTAGGCAATTCC
GATGTTTCCATCGCTAAATCAAATGCCAATATTTCAAACAGTTCATTACATATCATCAGTTAA