SecReT6
Protein ID: 300723436
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2520
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2470460..2470810 [+]
Producthypothetical protein
NoteTssJ
UniProt IDD3VHD3
KEGG IDxne:XNC1_2520
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.00E-15, Aligned region: 2..85
Protein Sequence: 116 a.a.     [Download]
>gi|300723436|ref|YP_003712741.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MSADFFSLREKAQNVLDDKLINEDPFFIRPAQTVYCLSEKNQPDANYIGIIAEYNQLNGKKWRLLFPVPT
AEKPAFYEFWRSSPDELPVCVKVTHNGLSFTKECHLSCPAGAEEKP
 
Nucleotide Sequence: 351 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2470460-2470810 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGTCTGCTGATTTCTTTTCACTGCGGGAGAAAGCGCAGAATGTGTTAGATGATAAATTAATTAACGAAG
ATCCATTTTTTATCCGGCCTGCGCAAACTGTCTATTGTTTATCAGAAAAAAACCAACCAGACGCTAACTA
TATCGGCATTATCGCTGAATATAATCAATTAAACGGAAAGAAATGGCGCCTGTTATTTCCCGTTCCTACA
GCCGAAAAACCCGCTTTTTATGAATTCTGGCGTTCTTCTCCGGATGAACTCCCTGTGTGCGTTAAAGTCA
CTCACAACGGTCTGAGTTTCACCAAAGAGTGTCACTTAAGTTGTCCTGCTGGAGCCGAAGAAAAACCATG
A