SecReT6
Protein ID: 300723437
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2521
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2470807..2472150 [+]
Producthypothetical protein
NoteTssK
UniProt IDD3VHD4
KEGG IDxne:XNC1_2521
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-141, Aligned region: 19..442
Protein Sequence: 447 a.a.     [Download]
>gi|300723437|ref|YP_003712742.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MNRSGKVIWTEGMFLRPHHFQQAENYLEAYTRDWGIAQASYYWGFLTLELDQESLNQSKIKLYSASGIFP
DGTPFSFDAAHAPTPLQLTENHSNTNIVLALPTFRRGKEDVIFSEKNDSLARFISFEAEVHDFNAMSVGN
AAIQFGKMRLRLMPESDLTPEWTALNITQVVNRTNDNKLHLDPSFIPPLLNCRANPQIIGFISDIQGLLE
QRRQQISQRLLQLGRYNDSEIMDFLLLSLLNRYSGQVNHMQNLSLLHPERLFSDWLQFATELATFSPNRL
PEDKLPLYDHDNLTQCFNRLMFQLRQGLSIILEEQAIQLPLTEYSHGLNIATLPDANMIHLFSFILAVHA
DIANDLLMSKFPAQMKISPVDRIRELVQLQLPGISLRAMPSIPRQIPWHSGYVYFELEKEGELWKQMEKS
GGFALHLAGEFPGLNIEFWAVRNQEKT
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2470807-2472150 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGAATAGATCAGGAAAAGTTATCTGGACAGAGGGTATGTTTTTGCGCCCCCATCATTTCCAACAGGCGG
AAAACTATTTAGAAGCCTACACACGTGACTGGGGAATAGCGCAAGCCTCTTACTATTGGGGGTTTTTGAC
ACTCGAACTGGATCAAGAATCACTCAATCAAAGTAAAATAAAACTTTACTCAGCCAGCGGCATTTTCCCT
GACGGAACCCCATTCAGTTTTGATGCGGCTCATGCACCTACGCCTTTGCAGCTCACTGAAAATCACTCAA
ATACTAACATCGTCCTGGCTCTGCCAACGTTCCGGCGAGGAAAAGAAGACGTCATTTTCAGTGAAAAAAA
CGACTCTTTGGCACGTTTTATCAGCTTTGAAGCTGAAGTCCATGACTTTAACGCTATGTCAGTCGGGAAT
GCCGCAATACAATTCGGCAAAATGCGTTTACGCCTGATGCCGGAATCAGATTTAACCCCGGAATGGACCG
CATTGAACATCACACAGGTTGTGAACAGAACGAATGATAACAAACTCCATCTTGATCCTTCATTTATTCC
GCCCTTACTCAACTGTCGCGCAAATCCGCAGATAATCGGTTTTATCAGTGACATACAGGGCTTACTGGAA
CAGCGACGCCAGCAAATCAGCCAACGTTTATTACAGTTAGGGCGTTATAATGATTCTGAAATCATGGATT
TCCTCTTGCTGTCACTTTTAAACCGTTACAGCGGTCAAGTGAATCATATGCAGAACCTGTCATTACTGCA
CCCTGAACGGTTATTTAGTGACTGGCTGCAATTTGCTACAGAACTGGCGACATTTTCCCCGAATCGTCTA
CCCGAAGATAAGCTACCGCTTTATGATCATGATAATTTGACCCAGTGTTTCAACCGACTTATGTTCCAAC
TGCGTCAGGGGCTATCCATCATTCTGGAAGAACAAGCGATTCAGCTACCCTTAACGGAATATTCTCATGG
CTTGAACATCGCAACCTTACCCGATGCCAACATGATACATCTGTTCAGCTTTATTCTGGCGGTTCATGCT
GATATTGCCAATGACCTGTTAATGAGTAAGTTCCCGGCTCAGATGAAAATTTCCCCGGTTGACCGCATAC
GTGAATTGGTTCAATTGCAATTGCCGGGTATTTCACTGCGGGCAATGCCATCCATTCCCAGACAAATTCC
CTGGCATTCAGGTTATGTTTATTTCGAATTAGAAAAAGAGGGGGAACTGTGGAAACAGATGGAAAAATCC
GGCGGCTTTGCATTGCATCTGGCAGGTGAGTTTCCGGGCCTGAACATCGAGTTCTGGGCTGTCCGCAATC
AGGAAAAAACGTAA