SecReT6
Protein ID: 300723438
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2522
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2472164..2473384 [+]
Producthypothetical protein
NoteTssL
UniProt IDD3VHD5
KEGG IDxne:XNC1_2522
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.20E-70, Aligned region: 20..223
DUF2077 [PF09850], Evalue: 7.20E-70, Aligned region: 357..392
OmpA [PF00691], Evalue: 3.00E-14, Aligned region: 291..391
Protein Sequence: 406 a.a.     [Download]
>gi|300723438|ref|YP_003712743.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MMQEEHKTAYRTPVDEAMCNPLVSAANPLLNTIPQIRHSTVHPDPTELRQKLINEIRQFEVVCQQAKLPY
EVIIAARYCLCTALDEAASLTPWGLRSVWSGSGLLVTFHNETWGGEKFFQLLAKLSQNPQENLFLLELIY
FCLLLGFEGRYRVIDNGRSQLETVKQRLYQLIRSIRGSHSVELSPKVQTITMPNKSWHFSLPTWVIATVL
SLLVCALYISLNSKLDSIINPVLAKIYQTNLPDLSVNNQVIPPTPPVLKLQSLLKDEIEAGLLTVTDMSD
RSIIVLKGDGLFKSSAIQIKSRYSAIIKHIAEALNSLQGNILVVGYTDNIPVSSRRSHFLSNYALSLARA
KSVQRELQRYLNQPERVSAEGKGAENPIAPNDTRSNRAKNRRVEITLLVSPVNQTM
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2472164-2473384 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGATGCAAGAAGAACACAAAACCGCATACCGTACTCCTGTTGATGAAGCGATGTGTAATCCATTGGTTT
CTGCCGCAAATCCACTGCTGAATACGATTCCCCAGATCCGGCACTCTACCGTTCACCCTGACCCGACAGA
GTTACGACAAAAGCTGATCAACGAAATCAGGCAGTTTGAAGTGGTATGCCAGCAAGCCAAACTGCCTTAT
GAGGTGATAATTGCAGCACGCTACTGTTTATGTACTGCACTGGACGAAGCGGCTTCACTCACTCCCTGGG
GGCTTCGCAGCGTTTGGTCCGGCAGCGGATTGTTAGTCACATTTCATAATGAAACCTGGGGAGGCGAAAA
ATTCTTCCAATTATTGGCCAAATTATCGCAAAATCCCCAAGAGAACCTGTTTCTGTTAGAACTCATTTAC
TTCTGTCTGCTGCTTGGATTTGAAGGACGCTATCGTGTGATTGATAACGGCCGTTCCCAGTTAGAAACCG
TAAAACAACGCCTGTATCAGTTAATACGTTCAATTCGGGGCAGTCATTCTGTTGAGTTATCACCCAAAGT
ACAAACGATCACAATGCCGAATAAATCTTGGCATTTTTCCTTACCGACGTGGGTTATTGCAACCGTATTA
AGCCTTTTGGTGTGTGCTCTGTATATCAGCCTGAATTCAAAATTGGATAGCATAATCAATCCTGTTCTGG
CAAAAATCTATCAAACGAACTTACCTGATTTATCCGTTAACAATCAGGTAATCCCCCCAACACCGCCGGT
ATTAAAACTACAAAGTCTATTAAAGGATGAAATAGAAGCCGGGTTATTAACGGTCACCGACATGTCAGAC
AGAAGCATCATTGTTCTGAAAGGTGATGGATTATTCAAAAGCAGCGCAATTCAGATCAAAAGCCGTTATT
CAGCGATTATCAAGCATATTGCAGAAGCACTGAATAGTCTCCAGGGCAATATCCTCGTCGTAGGGTATAC
CGATAATATACCGGTTTCTTCCCGTCGCTCACATTTTTTATCTAATTATGCGTTATCACTGGCGAGAGCC
AAATCAGTACAAAGGGAACTGCAACGCTATCTGAATCAACCAGAAAGGGTCAGTGCTGAGGGAAAAGGGG
CAGAAAATCCTATCGCGCCAAATGATACTCGCAGCAATCGGGCTAAAAACAGACGCGTTGAAATCACGCT
TTTAGTTTCTCCGGTAAATCAAACGATGTAA