SecReT6
Protein ID: 300723440
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2524
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2477036..2478082 [+]
Producthypothetical protein
NoteTssA
UniProt IDD3VHD7
KEGG IDxne:XNC1_2524
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.80E-19, Aligned region: 52..111
Protein Sequence: 348 a.a.     [Download]
>gi|300723440|ref|YP_003712745.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MNIDELLTPISAEYACGENLEYDDEFLALEQAIIEKPEKQFGDVIIPAEPPHWGEVEKHAIHLFSRTKDL
NVIIALMQAWINLRGLSGYADGLYLLRQTLERYWTEVWPRLEFDGSYDLLRRLNTLAAIEDNSPCTIKAQ
NSLLLKSASSELTLQEAYSLLSGSVTNISSYTGGRPRLINELKQKSASPEMLIIMTIRDHLTALIEIICH
HLSNSHMPELPQFLKQLDTIIKFCTTPDSETAKEKNPELLDSASSDTQGASMEQQTSEESVLFHWQSVEV
NHRDEAHILLEKAKAYFLKHEPSHPAPLMISRIQQLIDRDFMTIIQDLAPEGLNQLEIIFGHPHHSDI
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2477036-2478082 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGAATATTGATGAGTTACTGACGCCAATCAGTGCCGAATATGCCTGCGGAGAAAATCTGGAATACGATG
ACGAATTTCTGGCATTAGAACAGGCGATAATCGAAAAACCAGAAAAACAGTTTGGTGATGTCATCATCCC
GGCCGAACCTCCCCATTGGGGAGAGGTGGAAAAACACGCTATTCACCTGTTCTCCCGTACCAAAGATTTG
AATGTCATCATAGCGCTGATGCAGGCATGGATAAATTTACGCGGATTATCGGGTTATGCTGATGGTTTGT
ACTTACTCCGCCAAACGCTGGAACGTTATTGGACAGAGGTGTGGCCCAGACTGGAGTTTGATGGTTCGTA
TGACCTTTTACGGCGTTTAAACACGTTGGCCGCGATTGAAGACAACTCACCCTGTACGATAAAAGCCCAG
AATTCTCTTTTACTAAAAAGTGCTTCAAGCGAACTGACATTACAGGAAGCGTATTCACTGCTGAGTGGCT
CAGTCACCAATATTAGCAGTTATACCGGCGGGCGCCCCAGATTAATCAACGAGTTGAAACAAAAATCAGC
CAGTCCTGAAATGCTGATCATCATGACTATCCGTGATCATCTTACTGCCCTGATTGAGATAATTTGCCAT
CATTTATCCAACAGCCATATGCCCGAACTGCCACAGTTTCTGAAACAACTGGATACAATTATTAAATTTT
GTACCACTCCTGACTCAGAAACCGCGAAGGAAAAAAACCCGGAATTACTTGATTCAGCATCGTCGGATAC
ACAAGGCGCTTCAATGGAGCAACAAACCTCAGAAGAAAGCGTACTTTTCCATTGGCAATCCGTTGAGGTC
AATCATCGTGATGAAGCACACATCTTATTAGAAAAAGCCAAAGCCTATTTTCTTAAACACGAACCCAGCC
ACCCGGCGCCACTCATGATTAGTCGCATTCAACAGCTCATTGATCGTGATTTCATGACGATTATTCAAGA
TCTTGCACCAGAAGGATTAAACCAGCTAGAAATCATTTTTGGTCACCCACATCATTCTGATATTTGA