SecReT6
Protein ID: 300723441
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2525
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2478260..2478802 [+]
Producthypothetical protein
NoteTssB
UniProt IDD3VHD8
KEGG IDxne:XNC1_2525
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.50E-59, Aligned region: 9..161
Protein Sequence: 180 a.a.     [Download]
>gi|300723441|ref|YP_003712746.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MKSSGQKFIARNRAPRVQIEYDVELYGSEKVVQLPFIMGVVADLAGKPVEALPDVNDRKFLEIDIDNFDE
RMSSISPRAAFQVENTLTGEGKLNIDLTFKNMEDFQPDEIAKKVEPLAKLLEARIQLANLLSYMDGKNGA
EQLISEILQNPALLQSLAEAPNPENSASKDSTEDSTEDKE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2478260-2478802 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGAAATCCAGCGGACAGAAGTTTATAGCCCGGAACCGCGCTCCCCGCGTGCAGATTGAATATGACGTTG
AGCTTTATGGCTCAGAAAAAGTTGTTCAATTACCCTTTATCATGGGAGTTGTCGCTGATCTGGCAGGCAA
ACCTGTTGAAGCCCTGCCAGACGTCAATGACCGCAAATTCCTGGAAATTGACATTGATAACTTCGATGAA
CGTATGAGTTCAATCAGTCCTCGTGCCGCCTTTCAAGTTGAAAACACCTTAACCGGTGAGGGTAAGTTGA
ATATTGATCTGACGTTTAAAAATATGGAGGATTTTCAACCCGATGAAATAGCCAAAAAGGTAGAACCTCT
GGCCAAGCTATTAGAAGCCCGTATCCAATTGGCAAATTTACTGTCTTATATGGACGGTAAAAACGGAGCA
GAACAACTGATTTCCGAGATATTGCAAAACCCCGCCCTGCTGCAATCCCTGGCGGAAGCTCCAAATCCTG
AGAATAGCGCTTCAAAAGATAGCACTGAAGACAGCACAGAAGATAAGGAGTAA