SecReT6
Protein ID: 300723442
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2526
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2478806..2480308 [+]
Producthypothetical protein
NoteTssC
UniProt IDD3VHD9
KEGG IDxne:XNC1_2526
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-191, Aligned region: 69..495
Protein Sequence: 500 a.a.     [Download]
>gi|300723442|ref|YP_003712747.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MSTPEQDTLRQQEQIAKEYSPNELSTLLDKEFRPQSDHTRQAVENAVKTLAQQALENTVTLSGDTYRTIQ
SLIAEIDAKMSQQINHILHNKEFQTLEGAWRGLHHLVNNTETDEMLKIRVMCLSKKELSNTLKRFKGVSW
DQSPMFKKIYEAEYGQFGGEPFGCLIGDYYFDHTAPDVELLRQMAQISAAAHCPFITGAAPSVMQMKSWQ
ELANPRDLTKIFQNTEYAPWRSLRVSEDVRYIGLTLPRFLSRLPYGALTNPVDSFNFEENTEGPTHDNYT
WANSAYAMAVNINRSFKLYGWCTSIRGVESGGIVENMPCYTFPSDDGGVDMKCPTEIAISDRREAELAKN
GFIPLLHRKNTDMAAFIGAQSLQKPEEYYDPDATANANLSARLPYLFACCRFAHYLKCIVRDKIGTFQER
ADMERWLNDWITNYIDGDPVNSSQLTKARKPLAAAEVKVEEVESNPGYYQAKFFLRPHYQLEGLTVSLRL
VSKLPSLKGA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2478806-2480308 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGAGCACACCTGAACAAGACACTTTGCGTCAACAAGAACAGATCGCCAAAGAGTATAGCCCTAATGAAC
TCAGCACATTGCTGGATAAGGAATTTCGCCCGCAAAGCGATCATACACGCCAGGCCGTTGAAAATGCGGT
GAAAACACTGGCACAACAGGCATTGGAAAATACCGTTACCCTCTCCGGCGATACCTACCGTACCATCCAG
TCGCTCATTGCTGAAATTGACGCCAAAATGTCCCAGCAAATAAATCATATCCTGCACAACAAGGAATTTC
AGACCCTGGAAGGCGCCTGGCGGGGTTTACATCATCTGGTCAACAATACAGAAACGGATGAAATGCTGAA
AATTCGGGTGATGTGCCTTTCTAAAAAGGAATTGAGCAACACCCTAAAACGTTTCAAAGGCGTCAGTTGG
GACCAGAGCCCGATGTTCAAAAAAATCTACGAAGCGGAATATGGTCAGTTTGGTGGAGAACCCTTCGGCT
GTCTGATAGGCGATTATTATTTCGATCATACGGCACCGGATGTTGAACTCTTGCGCCAAATGGCACAAAT
CAGTGCGGCGGCACATTGTCCTTTCATTACCGGGGCTGCACCCAGTGTGATGCAAATGAAATCCTGGCAA
GAATTAGCCAATCCCCGTGATCTCACAAAAATTTTCCAAAACACGGAATATGCACCCTGGCGCAGTTTGC
GTGTATCAGAAGACGTGCGTTATATCGGGTTAACACTCCCGCGTTTTCTCTCCCGTTTACCCTATGGCGC
TCTTACCAATCCCGTTGACAGCTTCAATTTTGAGGAAAACACGGAAGGCCCGACCCACGATAACTACACC
TGGGCAAATTCGGCTTATGCTATGGCCGTCAATATTAATCGGTCGTTTAAGCTTTATGGCTGGTGTACCT
CTATTCGCGGTGTCGAATCCGGTGGGATTGTGGAAAACATGCCTTGCTATACATTCCCCTCCGATGATGG
TGGCGTGGATATGAAATGCCCCACTGAAATTGCGATTAGTGATCGCCGTGAAGCCGAATTGGCAAAGAAT
GGTTTTATTCCATTATTGCACCGTAAAAACACCGACATGGCGGCTTTTATTGGTGCGCAATCCCTGCAAA
AACCAGAAGAATATTACGATCCGGATGCGACCGCCAATGCCAACCTTTCAGCACGTCTGCCCTATTTATT
TGCCTGCTGCCGTTTTGCCCATTACCTGAAATGTATCGTGCGCGACAAAATAGGGACTTTTCAGGAACGT
GCTGATATGGAGCGTTGGCTGAATGATTGGATTACCAATTACATTGACGGTGATCCTGTCAACTCATCTC
AGCTGACTAAAGCCAGAAAGCCGCTTGCGGCCGCAGAAGTCAAGGTAGAAGAAGTAGAAAGCAACCCGGG
GTATTATCAGGCCAAATTTTTCCTGCGGCCTCATTATCAGCTCGAAGGTCTGACGGTTTCTTTACGTTTA
GTCTCAAAACTTCCCTCACTAAAAGGAGCTTAA