SecReT6
Protein ID: 300723443
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2527
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2480445..2480936 [+]
Producttype VI secretion system effector (Hcp1 family)
NoteTssD
UniProt IDD3VHE0
KEGG IDxne:XNC1_2527
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.30E-20, Aligned region: 9..137
Protein Sequence: 163 a.a.     [Download]
>gi|300723443|ref|YP_003712748.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MSTAGIDAFINFTNVTGESGDDTFKEWTAVKAFSLEVANSVNHDNQGTGLGSGIVDVSKLSVELLFDKAA
ITLRQYIVKGTHINDVKLNVRRQGGKQETWYSLVLTNALVSKSLLTYEGGLFHAAIELAFQKHKESYCSQ
EYGSGSKGAEISYEWDAHANKGG
 
Nucleotide Sequence: 492 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2480445-2480936 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGTCTACTGCAGGTATCGACGCGTTTATTAATTTTACTAATGTCACAGGCGAGTCAGGTGACGACACAT
TTAAAGAATGGACGGCAGTCAAAGCATTTTCACTTGAAGTCGCCAACAGTGTTAATCATGACAATCAAGG
TACAGGATTAGGCTCCGGTATCGTCGATGTTTCCAAATTGTCTGTTGAGCTTCTGTTCGATAAAGCGGCT
ATCACCTTGCGCCAGTATATCGTCAAGGGAACACATATTAATGACGTTAAGCTTAATGTACGCAGACAAG
GGGGTAAACAAGAAACCTGGTATTCATTAGTGTTGACAAATGCGCTGGTTTCAAAATCCCTGTTGACGTA
TGAAGGCGGCCTTTTCCATGCCGCTATTGAGTTAGCCTTTCAAAAACATAAAGAAAGCTACTGTTCTCAA
GAATACGGTTCAGGTTCTAAAGGCGCCGAAATCAGCTATGAATGGGATGCTCACGCCAACAAAGGCGGTT
AA