SecReT6
Protein ID: 300723444
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2528
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2481008..2482537 [+]
Producthypothetical protein
NoteFha
UniProt IDD3VHE1
KEGG IDxne:XNC1_2528
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.70E-07, Aligned region: 28..96
Protein Sequence: 509 a.a.     [Download]
>gi|300723444|ref|YP_003712749.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MMRFSIVKNAGTTQPPYLSYDFSPPGGTIGRSMDNSWVLPDEELAIARLQAIVSVSAHGECWINNQGSAS
EVLLNKVPLAPERQVEIRDGDMLNIGHYQIQLIDIKKNPVPPENNSQSDVPGGIWDELEHILTASNKSSP
QERHQTPQAAGDNNPLIKDQPNEERNPINPLAHINPATDLETHPLRSTDPMTMFNADTPFRQENIFHDQT
PTTLLQRNEKYGNQEDDKKDVDPLALFSEKPARHIKNDDPLNPILNHAVPLTASNSATASEPLFTPASQS
VSTESVSHESQTSSLSSFFATPHDNQAHGTQSEGKLLASLLEGMGLKDRHRFEFDEQLMYQLGRLVSQLS
QGIIVLNASRHQFKHKLDADMTQILSDIHNPFKLLPSGQSVLTLMFSDHMPGFMPLEEATHDILTELQAH
QSGMIAGIRATVADILHSFHPVMLEQTAQDENYLPRLSLSSTYKASIWDYFTQHYQAISKQFEQESSLFG
ENFLQAYSAEVNRYKTAKK
 
Nucleotide Sequence: 1530 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2481008-2482537 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGATGCGATTCTCCATTGTTAAAAACGCTGGCACCACCCAACCTCCGTACTTGAGTTATGACTTTTCCC
CTCCTGGCGGCACTATCGGTCGTAGCATGGATAATAGCTGGGTTCTGCCCGATGAGGAATTGGCTATTGC
CCGGTTACAAGCCATTGTGTCCGTTTCTGCTCATGGAGAGTGCTGGATTAACAATCAAGGTTCTGCATCT
GAGGTTTTATTGAACAAGGTACCGTTGGCACCTGAACGTCAGGTTGAAATCCGTGATGGTGATATGCTGA
ATATCGGCCATTATCAAATTCAACTTATTGATATCAAAAAAAATCCAGTCCCACCGGAAAACAATAGCCA
GTCAGACGTTCCCGGTGGAATTTGGGATGAGCTTGAGCACATTCTCACAGCTTCCAATAAATCGTCCCCT
CAAGAGAGACACCAGACTCCCCAGGCAGCAGGCGACAATAACCCCCTGATAAAAGATCAACCCAATGAAG
AACGAAATCCGATTAACCCGCTGGCACACATTAATCCGGCAACCGATCTTGAGACACATCCATTGCGGTC
AACTGATCCCATGACGATGTTCAATGCAGATACCCCTTTCCGGCAGGAAAATATCTTCCATGATCAGACA
CCTACGACGCTGTTACAACGCAATGAAAAATACGGGAACCAAGAGGATGATAAAAAGGACGTTGACCCGT
TAGCCTTGTTTTCTGAAAAGCCGGCACGACACATCAAAAATGATGACCCCTTGAATCCAATCTTGAATCA
TGCAGTACCACTGACGGCTTCAAATAGTGCAACGGCTTCTGAACCGCTGTTTACACCTGCTTCACAATCC
GTATCGACTGAATCTGTCTCTCATGAAAGTCAAACATCATCCTTATCCTCCTTCTTCGCCACCCCCCATG
ATAATCAAGCTCATGGAACCCAATCAGAAGGAAAATTATTGGCATCCTTACTTGAGGGCATGGGATTAAA
AGATCGCCACAGATTTGAATTTGATGAACAGCTCATGTATCAGTTAGGCCGGTTGGTCAGCCAGCTTTCC
CAGGGGATCATTGTCCTTAACGCTTCACGTCACCAGTTCAAACACAAATTAGATGCAGACATGACCCAAA
TACTGTCGGATATACATAATCCATTTAAACTTTTACCTTCCGGTCAGTCTGTTTTGACCCTGATGTTTAG
TGACCATATGCCGGGGTTTATGCCACTGGAGGAAGCTACCCATGATATTCTGACCGAATTACAGGCACAT
CAATCGGGTATGATTGCAGGAATACGTGCCACAGTGGCCGATATATTACATTCATTCCATCCCGTTATGC
TTGAACAAACAGCGCAGGATGAAAATTACTTGCCACGTTTATCACTATCATCAACCTACAAAGCATCAAT
ATGGGATTATTTCACCCAACATTACCAGGCAATCAGCAAACAATTTGAACAAGAATCGTCACTGTTTGGC
GAAAATTTCCTGCAAGCTTATTCAGCAGAAGTTAACCGCTATAAAACCGCCAAAAAATAA