SecReT6
Protein ID: 300723445
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2529
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2482599..2483153 [+]
Producthypothetical protein
NoteTssE
UniProt IDD3VHE2
KEGG IDxne:XNC1_2529
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-14, Aligned region: 53..158
Protein Sequence: 184 a.a.     [Download]
>gi|300723445|ref|YP_003712750.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MNDNITVLRGGYHSRSNTTRITAKDRMQPSLLDKLTDNESDKKHETTNNYLLSHSALRQTVLRDLQWLLN
SINSESEQDLSAFPEISRSVYNFGLAPTAGKCISEIEWEDIQHRIITAIRIFEPRIMPDGLEVNCISDAN
ELILYNTLPIEIKGFLWCIPWPLEFLFHSHIDLENGYFTIKEAS
 
Nucleotide Sequence: 555 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2482599-2483153 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGAATGACAATATCACTGTGCTGCGTGGAGGTTATCATAGCCGGAGCAACACGACCCGCATCACTGCCA
AAGATCGCATGCAACCGTCTTTGCTGGATAAACTGACAGATAATGAATCTGATAAAAAACATGAGACTAC
TAACAACTACCTATTGTCACACAGTGCGTTACGTCAGACTGTCCTGAGGGACTTACAGTGGTTGCTAAAC
AGCATTAACAGCGAATCAGAACAAGACCTTAGCGCATTTCCTGAAATTAGCCGATCCGTGTATAACTTCG
GCCTGGCTCCCACGGCAGGTAAATGTATTTCTGAAATAGAATGGGAAGATATTCAACATCGCATTATTAC
CGCTATCCGCATATTCGAACCCCGTATCATGCCTGATGGGCTTGAAGTGAACTGCATTTCTGATGCCAAT
GAATTGATCTTGTACAATACGTTACCTATAGAAATCAAAGGGTTTTTATGGTGTATACCCTGGCCGCTTG
AATTCCTGTTCCACAGTCATATCGATCTGGAAAACGGTTATTTCACTATAAAAGAAGCGAGTTAA