SecReT6
Protein ID: 300723446
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2530
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2483187..2485061 [+]
Producthypothetical protein
NoteTssF
UniProt IDD3VHE3
KEGG IDxne:XNC1_2530
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.50E-201, Aligned region: 5..624
Protein Sequence: 624 a.a.     [Download]
>gi|300723446|ref|YP_003712751.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MDSKLLEYYNRELVYLREMGKEFAERYPKVANRLGMHGIDVADPYVERLMEGFAFLTSRIQLKMDAEFPR
FSGHLLEMLYPNYLSPTPSMAIVELQPDTRKGDISHGFSVPRGTLMHCQTLKRDGITLQYATTQDVILQP
LHLENVELGKIPANLPLAGLNLNHYGAVSALRIRFSCKEKFFLNELDFNKLIFFLSGPDIQSQQLLELIM
EHSVGIVCQILGDDPQYQVLPDISPHHEGFDDNQSLFPDDPRNFSGYRQLQEYFAFPARFQFFSLSGMGS
LLKQTTKKSEFELILLLNKVDTDLESLVDTSYLTLNCTPVINLFPKVTERITVQESNNEYHLVVDNSRPL
DYEIFSVQRLHGANIKRKETQIFRPFWSTFSDDKNNYGAYFSLRRDPRVLSEHARHYGTRSSYIGTEMFV
SIVDEQHSPWPDQLKFLTADVMCTNRDLPTMLRQQDLDNFAMLDSIPIHQIAFLKRPTIPHPALAQGSAT
WKLINQLQLNYLNFMDKGDEQGTQALRQLLSLYANLADPAITRQINGIRHCSLKTVYRRVPEPGPIVFAR
GVSIRLEVNEQEFAGVSPWLLGSVLGKLFSHLVTMNSFTEMTLYSQQRGDIGFWPASMGNKKLI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2483187-2485061 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
TTGGACAGCAAGTTACTTGAATATTACAACCGCGAATTAGTGTATCTGCGTGAAATGGGTAAAGAATTTG
CCGAACGTTACCCTAAAGTTGCCAATCGTCTGGGTATGCACGGTATTGATGTTGCCGATCCCTATGTTGA
ACGCCTGATGGAAGGATTCGCTTTTCTGACATCCCGCATTCAATTGAAAATGGATGCGGAATTCCCGCGT
TTTTCCGGGCACTTACTGGAAATGTTGTATCCTAACTATCTGTCTCCGACCCCTTCAATGGCCATTGTCG
AACTCCAGCCAGATACCCGCAAAGGCGATATCAGCCACGGATTTTCAGTACCACGCGGAACACTTATGCA
CTGCCAGACCTTAAAAAGAGATGGCATTACTTTGCAATATGCGACAACACAAGATGTCATCCTGCAACCT
TTGCATCTGGAAAATGTTGAACTGGGCAAGATCCCCGCGAACCTGCCGCTGGCCGGCTTAAACCTTAACC
ACTATGGTGCGGTCAGTGCACTGCGGATACGTTTTAGTTGTAAAGAAAAATTTTTCCTCAATGAGCTGGA
TTTCAACAAACTCATCTTTTTCCTTTCAGGTCCGGACATTCAATCCCAACAGTTGCTGGAACTGATTATG
GAGCACTCTGTTGGCATCGTATGCCAAATTCTGGGTGATGATCCCCAATATCAGGTTTTGCCCGATATTT
CACCCCATCATGAAGGATTTGATGATAATCAATCCTTATTCCCTGACGATCCACGTAATTTTAGTGGTTA
TCGGCAACTTCAGGAATATTTTGCATTTCCGGCACGTTTCCAGTTTTTCAGTCTCAGCGGAATGGGATCA
TTACTGAAACAGACCACAAAAAAGAGTGAGTTTGAGCTGATTTTGCTGTTAAACAAAGTCGATACCGATT
TGGAAAGTTTGGTGGATACCTCTTACCTGACGTTAAATTGTACACCTGTGATTAATTTATTTCCCAAAGT
GACTGAACGTATCACCGTACAAGAAAGCAACAATGAATATCATTTAGTTGTTGATAATTCACGTCCTCTG
GATTACGAAATTTTTTCGGTGCAACGTCTGCACGGGGCGAATATCAAGCGCAAAGAAACACAAATATTCC
GACCCTTCTGGTCTACTTTCAGCGACGATAAAAACAATTACGGTGCCTATTTTTCTTTGCGCCGTGATCC
CCGCGTCTTATCTGAACATGCCCGTCATTACGGAACCCGATCGAGCTATATCGGTACAGAAATGTTTGTC
TCTATTGTTGATGAGCAACACTCTCCGTGGCCTGATCAACTGAAATTCCTGACTGCGGATGTTATGTGTA
CCAACCGTGATTTACCCACAATGCTGCGCCAACAAGATCTCGATAATTTTGCCATGCTGGATTCTATCCC
CATTCATCAAATTGCCTTTCTCAAACGACCGACAATCCCGCATCCGGCCTTGGCCCAGGGTTCTGCCACC
TGGAAATTAATCAATCAACTACAACTCAATTACTTGAATTTTATGGATAAAGGAGATGAACAAGGAACGC
AGGCATTACGACAATTACTGAGTCTATATGCAAATCTGGCAGATCCCGCTATCACCCGCCAGATTAATGG
CATTCGCCATTGCTCATTAAAGACGGTTTACCGACGGGTTCCGGAACCCGGGCCAATCGTATTTGCCCGT
GGTGTCAGTATCCGGCTTGAAGTGAATGAACAGGAATTCGCCGGGGTCAGCCCTTGGTTACTGGGCAGTG
TATTGGGTAAACTTTTCTCGCATTTGGTCACCATGAACTCATTTACTGAAATGACATTGTATAGCCAGCA
ACGTGGTGATATCGGCTTTTGGCCTGCCAGTATGGGTAACAAAAAATTAATATAA